Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2097717..2098426 | Replicon | chromosome |
| Accession | NZ_CP117963 | ||
| Organism | Faecalibacterium prausnitzii strain AP34BHI | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PT301_RS10150 | Protein ID | WP_118551954.1 |
| Coordinates | 2097717..2097908 (+) | Length | 64 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PT301_RS10155 | Protein ID | WP_118551952.1 |
| Coordinates | 2098049..2098426 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT301_RS10130 | 2092890..2095010 | - | 2121 | WP_118551960.1 | ribonuclease R | - |
| PT301_RS10135 | 2095244..2095492 | - | 249 | WP_097792492.1 | preprotein translocase subunit SecG | - |
| PT301_RS10140 | 2095592..2097181 | - | 1590 | WP_118551958.1 | penicillin-binding transpeptidase domain-containing protein | - |
| PT301_RS10145 | 2097335..2097604 | + | 270 | WP_270476948.1 | helix-turn-helix transcriptional regulator | - |
| PT301_RS10150 | 2097717..2097908 | + | 192 | WP_118551954.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PT301_RS10155 | 2098049..2098426 | + | 378 | WP_118551952.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PT301_RS10160 | 2098511..2099461 | - | 951 | WP_118551950.1 | hypothetical protein | - |
| PT301_RS10165 | 2099478..2100473 | - | 996 | WP_118551948.1 | DUF4065 domain-containing protein | - |
| PT301_RS10170 | 2100761..2102404 | - | 1644 | WP_118551946.1 | chaperonin GroEL | - |
| PT301_RS10175 | 2102455..2102742 | - | 288 | WP_055187788.1 | co-chaperone GroES | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL | 2092890..2102742 | 9852 | |
| - | inside | Prophage | - | groEL | 2088779..2102742 | 13963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7076.31 Da Isoelectric Point: 10.6709
>T272564 WP_118551954.1 NZ_CP117963:2097717-2097908 [Faecalibacterium prausnitzii]
MPMTPKQMIRLLEQNGFVLVSANGSHYKYHNPTTNQTTVVPFHAKDLKPGTEKNILKLAGLKK
MPMTPKQMIRLLEQNGFVLVSANGSHYKYHNPTTNQTTVVPFHAKDLKPGTEKNILKLAGLKK
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14016.96 Da Isoelectric Point: 4.1445
>AT272564 WP_118551952.1 NZ_CP117963:2098049-2098426 [Faecalibacterium prausnitzii]
MNAIFYPAIFHPEETGYSVEIPDIEGCFTQGDTMDEAVRMAQDAIGLMLEDCKVCPEPSIPSALHVDPEDFVVMVPFDME
EYEKRYRPVKKTLSIPGWLNDAAESAHINFSGVLQDALKEKLHLA
MNAIFYPAIFHPEETGYSVEIPDIEGCFTQGDTMDEAVRMAQDAIGLMLEDCKVCPEPSIPSALHVDPEDFVVMVPFDME
EYEKRYRPVKKTLSIPGWLNDAAESAHINFSGVLQDALKEKLHLA
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|