Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4079627..4080458 | Replicon | chromosome |
| Accession | NZ_CP117962 | ||
| Organism | Escherichia coli strain JM109 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | PT299_RS20890 | Protein ID | WP_000854814.1 |
| Coordinates | 4079627..4080001 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | PT299_RS20895 | Protein ID | WP_001285584.1 |
| Coordinates | 4080090..4080458 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT299_RS20850 (4075023) | 4075023..4076189 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| PT299_RS20855 (4076308) | 4076308..4076781 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| PT299_RS20860 (4076979) | 4076979..4078037 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| PT299_RS20865 (4078209) | 4078209..4078538 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| PT299_RS20870 (4078639) | 4078639..4078773 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| PT299_RS20875 (4078893) | 4078893..4079021 | + | 129 | Protein_3825 | transposase domain-containing protein | - |
| PT299_RS20880 (4079310) | 4079310..4079390 | - | 81 | Protein_3826 | hypothetical protein | - |
| PT299_RS20885 (4079436) | 4079436..4079630 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| PT299_RS20890 (4079627) | 4079627..4080001 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PT299_RS20895 (4080090) | 4080090..4080458 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PT299_RS20900 (4080532) | 4080532..4080753 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| PT299_RS20905 (4080816) | 4080816..4081262 | - | 447 | WP_000187523.1 | RadC family protein | - |
| PT299_RS20910 (4081259) | 4081259..4082791 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T272559 WP_000854814.1 NZ_CP117962:c4080001-4079627 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT272559 WP_001285584.1 NZ_CP117962:c4080458-4080090 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |