Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 1705867..1706462 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | PT299_RS09555 | Protein ID | WP_000239577.1 |
Coordinates | 1705867..1706217 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | PT299_RS09560 | Protein ID | WP_001223208.1 |
Coordinates | 1706211..1706462 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS09535 (1701313) | 1701313..1702335 | - | 1023 | WP_001313531.1 | ABC transporter permease | - |
PT299_RS09540 (1702349) | 1702349..1703851 | - | 1503 | WP_000205825.1 | sugar ABC transporter ATP-binding protein | - |
PT299_RS09545 (1703991) | 1703991..1704947 | - | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
PT299_RS09550 (1705257) | 1705257..1705787 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
PT299_RS09555 (1705867) | 1705867..1706217 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
PT299_RS09560 (1706211) | 1706211..1706462 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
PT299_RS09565 (1706674) | 1706674..1707015 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
PT299_RS09570 (1707018) | 1707018..1710797 | - | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T272549 WP_000239577.1 NZ_CP117962:c1706217-1705867 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |