Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 1620856..1621670 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | PT299_RS09120 | Protein ID | WP_001054376.1 |
Coordinates | 1620856..1621113 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | PT299_RS09125 | Protein ID | WP_001309181.1 |
Coordinates | 1621125..1621670 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS09095 (1616144) | 1616144..1617250 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
PT299_RS09100 (1617315) | 1617315..1618295 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
PT299_RS09105 (1618405) | 1618405..1618610 | + | 206 | Protein_1543 | HNH endonuclease | - |
PT299_RS09110 (1618878) | 1618878..1620118 | - | 1241 | Protein_1544 | helicase YjhR | - |
PT299_RS09115 (1620234) | 1620234..1620365 | + | 132 | WP_001309182.1 | hypothetical protein | - |
PT299_RS09120 (1620856) | 1620856..1621113 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
PT299_RS09125 (1621125) | 1621125..1621670 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
PT299_RS09130 (1621726) | 1621726..1622472 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
PT299_RS09135 (1622641) | 1622641..1622859 | + | 219 | Protein_1549 | hypothetical protein | - |
PT299_RS09140 (1622897) | 1622897..1623013 | + | 117 | Protein_1550 | VOC family protein | - |
PT299_RS09145 (1623258) | 1623258..1624379 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
PT299_RS09150 (1624376) | 1624376..1624654 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
PT299_RS09155 (1624666) | 1624666..1625979 | + | 1314 | WP_000460842.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 1609870..1629894 | 20024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T272548 WP_001054376.1 NZ_CP117962:1620856-1621113 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT272548 WP_001309181.1 NZ_CP117962:1621125-1621670 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|