Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 149492..150130 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PT299_RS02000 | Protein ID | WP_000813794.1 |
Coordinates | 149954..150130 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PT299_RS01995 | Protein ID | WP_001270286.1 |
Coordinates | 149492..149908 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS01975 (144644) | 144644..145585 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
PT299_RS01980 (145586) | 145586..146599 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
PT299_RS01985 (146617) | 146617..147762 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
PT299_RS01990 (148007) | 148007..149413 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
PT299_RS01995 (149492) | 149492..149908 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PT299_RS02000 (149954) | 149954..150130 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PT299_RS02005 (150352) | 150352..150582 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PT299_RS02010 (150674) | 150674..152635 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PT299_RS02015 (152708) | 152708..153244 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PT299_RS02020 (153336) | 153336..154511 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T272543 WP_000813794.1 NZ_CP117962:c150130-149954 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT272543 WP_001270286.1 NZ_CP117962:c149908-149492 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|