Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 154898..155523 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117961 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PT299_RS00860 | Protein ID | WP_000911324.1 |
Coordinates | 154898..155296 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | PT299_RS00865 | Protein ID | WP_000450532.1 |
Coordinates | 155296..155523 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS00845 (151206) | 151206..151727 | + | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
PT299_RS00850 (151752) | 151752..152483 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
PT299_RS00855 (152736) | 152736..154889 | + | 2154 | WP_053905128.1 | type IV conjugative transfer system coupling protein TraD | - |
PT299_RS00860 (154898) | 154898..155296 | - | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PT299_RS00865 (155296) | 155296..155523 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 1..231544 | 231544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T272539 WP_000911324.1 NZ_CP117961:c155296-154898 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|