Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 109273..109798 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117961 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | PT299_RS00570 | Protein ID | WP_001159868.1 |
Coordinates | 109493..109798 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PT299_RS00565 | Protein ID | WP_000813634.1 |
Coordinates | 109273..109491 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS00550 (104429) | 104429..105328 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
PT299_RS00555 (105378) | 105378..107603 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
PT299_RS00560 (107605) | 107605..108693 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
PT299_RS00565 (109273) | 109273..109491 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PT299_RS00570 (109493) | 109493..109798 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PT299_RS00575 (109799) | 109799..110605 | + | 807 | WP_000016982.1 | site-specific integrase | - |
PT299_RS00580 (111379) | 111379..112134 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PT299_RS00585 (112722) | 112722..113888 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 1..231544 | 231544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T272535 WP_001159868.1 NZ_CP117961:109493-109798 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|