Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 11036..11715 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117961 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | PT299_RS00075 | Protein ID | WP_000854672.1 |
Coordinates | 11036..11377 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | PT299_RS00080 | Protein ID | WP_000070395.1 |
Coordinates | 11398..11715 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS00050 (6313) | 6313..6714 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
PT299_RS00055 (6753) | 6753..7808 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
PT299_RS00060 (8096) | 8096..9199 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
PT299_RS00065 (9211) | 9211..10464 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
PT299_RS00075 (11036) | 11036..11377 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
PT299_RS00080 (11398) | 11398..11715 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
PT299_RS00085 (11734) | 11734..11955 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
PT299_RS00090 (11964) | 11964..12440 | - | 477 | WP_000811693.1 | RadC family protein | - |
PT299_RS00095 (12456) | 12456..12914 | - | 459 | WP_000211838.1 | antirestriction protein | - |
PT299_RS00100 (13012) | 13012..13251 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
PT299_RS00105 (13328) | 13328..13795 | - | 468 | WP_001547765.1 | protein YkfB | - |
PT299_RS00110 (13818) | 13818..14261 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
PT299_RS00115 (14261) | 14261..14488 | - | 228 | WP_001548158.1 | protein YpjK | - |
PT299_RS00120 (14484) | 14484..14675 | - | 192 | Protein_22 | DeoR family transcriptional regulator | - |
PT299_RS00125 (14892) | 14892..15713 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
PT299_RS00130 (15805) | 15805..16668 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 1..231544 | 231544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T272534 WP_000854672.1 NZ_CP117961:c11377-11036 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|