Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3536732..3537386 | Replicon | chromosome |
Accession | NZ_CP117960 | ||
Organism | Escherichia coli strain B-3008 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | PT288_RS17205 | Protein ID | WP_000244777.1 |
Coordinates | 3536979..3537386 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PT288_RS17200 | Protein ID | WP_000354046.1 |
Coordinates | 3536732..3536998 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT288_RS17175 (3531901) | 3531901..3532644 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
PT288_RS17180 (3532701) | 3532701..3534134 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
PT288_RS17185 (3534179) | 3534179..3534490 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PT288_RS17190 (3534654) | 3534654..3535313 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
PT288_RS17195 (3535509) | 3535509..3536489 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
PT288_RS17200 (3536732) | 3536732..3536998 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PT288_RS17205 (3536979) | 3536979..3537386 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
PT288_RS17210 (3537426) | 3537426..3537947 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
PT288_RS17215 (3538059) | 3538059..3538955 | + | 897 | WP_000806628.1 | site-specific tyrosine recombinase XerD | - |
PT288_RS17220 (3538980) | 3538980..3539690 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PT288_RS17225 (3539696) | 3539696..3541429 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T272527 WP_000244777.1 NZ_CP117960:3536979-3537386 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |