Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1678290..1679077 Replicon chromosome
Accession NZ_CP117960
Organism Escherichia coli strain B-3008

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag PT288_RS08360 Protein ID WP_001194695.1
Coordinates 1678700..1679077 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag PT288_RS08355 Protein ID WP_000066236.1
Coordinates 1678290..1678649 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT288_RS08310 (1673530) 1673530..1673982 + 453 WP_001020418.1 hypothetical protein -
PT288_RS08315 (1673979) 1673979..1674431 + 453 WP_000734138.1 hypothetical protein -
PT288_RS08320 (1674494) 1674494..1675036 + 543 WP_001104018.1 DUF4339 domain-containing protein -
PT288_RS08325 (1675095) 1675095..1675547 + 453 WP_001061894.1 IrmA family protein -
PT288_RS08330 (1675624) 1675624..1675857 + 234 WP_001114682.1 DUF905 domain-containing protein -
PT288_RS08335 (1675977) 1675977..1676795 + 819 WP_001234406.1 DUF932 domain-containing protein -
PT288_RS08340 (1677063) 1677063..1677533 + 471 WP_000131762.1 antirestriction protein -
PT288_RS08345 (1677545) 1677545..1678024 + 480 WP_000437750.1 DNA repair protein RadC -
PT288_RS08350 (1678045) 1678045..1678266 + 222 WP_000691981.1 DUF987 domain-containing protein -
PT288_RS08355 (1678290) 1678290..1678649 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PT288_RS08360 (1678700) 1678700..1679077 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
PT288_RS08365 (1679074) 1679074..1679565 + 492 WP_000777682.1 DUF5983 family protein -
PT288_RS08370 (1679597) 1679597..1679800 + 204 WP_000413747.1 DUF957 domain-containing protein -
PT288_RS08375 (1679881) 1679881..1680725 + 845 Protein_1643 DUF4942 domain-containing protein -
PT288_RS08385 (1681067) 1681067..1681798 - 732 WP_001300756.1 DNA polymerase III subunit epsilon -
PT288_RS08390 (1681863) 1681863..1682330 + 468 WP_000917883.1 ribonuclease HI -
PT288_RS08395 (1682327) 1682327..1683049 - 723 WP_001297210.1 class I SAM-dependent methyltransferase -
PT288_RS08400 (1683083) 1683083..1683838 + 756 WP_001052717.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T272520 WP_001194695.1 NZ_CP117960:1678700-1679077 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT272520 WP_000066236.1 NZ_CP117960:1678290-1678649 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References