Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1678290..1679077 | Replicon | chromosome |
| Accession | NZ_CP117960 | ||
| Organism | Escherichia coli strain B-3008 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A377E3D6 |
| Locus tag | PT288_RS08360 | Protein ID | WP_001194695.1 |
| Coordinates | 1678700..1679077 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2H9G3E7 |
| Locus tag | PT288_RS08355 | Protein ID | WP_000066236.1 |
| Coordinates | 1678290..1678649 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT288_RS08310 (1673530) | 1673530..1673982 | + | 453 | WP_001020418.1 | hypothetical protein | - |
| PT288_RS08315 (1673979) | 1673979..1674431 | + | 453 | WP_000734138.1 | hypothetical protein | - |
| PT288_RS08320 (1674494) | 1674494..1675036 | + | 543 | WP_001104018.1 | DUF4339 domain-containing protein | - |
| PT288_RS08325 (1675095) | 1675095..1675547 | + | 453 | WP_001061894.1 | IrmA family protein | - |
| PT288_RS08330 (1675624) | 1675624..1675857 | + | 234 | WP_001114682.1 | DUF905 domain-containing protein | - |
| PT288_RS08335 (1675977) | 1675977..1676795 | + | 819 | WP_001234406.1 | DUF932 domain-containing protein | - |
| PT288_RS08340 (1677063) | 1677063..1677533 | + | 471 | WP_000131762.1 | antirestriction protein | - |
| PT288_RS08345 (1677545) | 1677545..1678024 | + | 480 | WP_000437750.1 | DNA repair protein RadC | - |
| PT288_RS08350 (1678045) | 1678045..1678266 | + | 222 | WP_000691981.1 | DUF987 domain-containing protein | - |
| PT288_RS08355 (1678290) | 1678290..1678649 | + | 360 | WP_000066236.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT288_RS08360 (1678700) | 1678700..1679077 | + | 378 | WP_001194695.1 | TA system toxin CbtA family protein | Toxin |
| PT288_RS08365 (1679074) | 1679074..1679565 | + | 492 | WP_000777682.1 | DUF5983 family protein | - |
| PT288_RS08370 (1679597) | 1679597..1679800 | + | 204 | WP_000413747.1 | DUF957 domain-containing protein | - |
| PT288_RS08375 (1679881) | 1679881..1680725 | + | 845 | Protein_1643 | DUF4942 domain-containing protein | - |
| PT288_RS08385 (1681067) | 1681067..1681798 | - | 732 | WP_001300756.1 | DNA polymerase III subunit epsilon | - |
| PT288_RS08390 (1681863) | 1681863..1682330 | + | 468 | WP_000917883.1 | ribonuclease HI | - |
| PT288_RS08395 (1682327) | 1682327..1683049 | - | 723 | WP_001297210.1 | class I SAM-dependent methyltransferase | - |
| PT288_RS08400 (1683083) | 1683083..1683838 | + | 756 | WP_001052717.1 | hydroxyacylglutathione hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14180.97 Da Isoelectric Point: 7.4209
>T272520 WP_001194695.1 NZ_CP117960:1678700-1679077 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A377E3D6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2H9G3E7 |