Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 994608..995313 | Replicon | chromosome |
Accession | NZ_CP117960 | ||
Organism | Escherichia coli strain B-3008 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | PT288_RS04970 | Protein ID | WP_000539521.1 |
Coordinates | 994608..994994 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PT288_RS04975 | Protein ID | WP_001280945.1 |
Coordinates | 994984..995313 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT288_RS04950 (990612) | 990612..991238 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
PT288_RS04955 (991235) | 991235..992350 | - | 1116 | WP_000555031.1 | aldose sugar dehydrogenase YliI | - |
PT288_RS04960 (992461) | 992461..992844 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
PT288_RS04965 (993057) | 993057..994382 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
PT288_RS04970 (994608) | 994608..994994 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT288_RS04975 (994984) | 994984..995313 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
PT288_RS04980 (995383) | 995383..996711 | - | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
PT288_RS04985 (996719) | 996719..999067 | - | 2349 | WP_012304894.1 | EAL domain-containing protein | - |
PT288_RS04990 (999245) | 999245..1000156 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T272517 WP_000539521.1 NZ_CP117960:994608-994994 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|