Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 366430..367068 | Replicon | chromosome |
| Accession | NZ_CP117960 | ||
| Organism | Escherichia coli strain B-3008 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PT288_RS01840 | Protein ID | WP_000813794.1 |
| Coordinates | 366892..367068 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PT288_RS01835 | Protein ID | WP_001270286.1 |
| Coordinates | 366430..366846 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT288_RS01815 (361582) | 361582..362523 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| PT288_RS01820 (362524) | 362524..363537 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| PT288_RS01825 (363555) | 363555..364700 | - | 1146 | WP_000047426.1 | ABC transporter substrate-binding protein | - |
| PT288_RS01830 (364945) | 364945..366351 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| PT288_RS01835 (366430) | 366430..366846 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PT288_RS01840 (366892) | 366892..367068 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PT288_RS01845 (367290) | 367290..367520 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| PT288_RS01850 (367612) | 367612..369573 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PT288_RS01855 (369646) | 369646..370182 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PT288_RS01860 (370274) | 370274..371449 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T272516 WP_000813794.1 NZ_CP117960:c367068-366892 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT272516 WP_001270286.1 NZ_CP117960:c366846-366430 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|