Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4641844..4642676 | Replicon | chromosome |
| Accession | NZ_CP117959 | ||
| Organism | Escherichia coli strain B-2207 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | PT284_RS23250 | Protein ID | WP_000854765.1 |
| Coordinates | 4642302..4642676 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | PT284_RS23245 | Protein ID | WP_001540478.1 |
| Coordinates | 4641844..4642212 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT284_RS23215 (4638962) | 4638962..4639157 | + | 196 | Protein_4385 | DUF905 family protein | - |
| PT284_RS23220 (4639275) | 4639275..4640093 | + | 819 | WP_274270998.1 | DUF932 domain-containing protein | - |
| PT284_RS23225 (4640093) | 4640093..4640266 | + | 174 | WP_001183321.1 | hypothetical protein | - |
| PT284_RS23230 (4640432) | 4640432..4640905 | + | 474 | WP_021532903.1 | antirestriction protein | - |
| PT284_RS23235 (4640921) | 4640921..4641397 | + | 477 | WP_001186786.1 | RadC family protein | - |
| PT284_RS23240 (4641460) | 4641460..4641681 | + | 222 | WP_021532904.1 | DUF987 domain-containing protein | - |
| PT284_RS23245 (4641844) | 4641844..4642212 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT284_RS23250 (4642302) | 4642302..4642676 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| PT284_RS23255 (4642673) | 4642673..4643164 | + | 492 | WP_001586604.1 | DUF5983 family protein | - |
| PT284_RS23260 (4643181) | 4643181..4643357 | + | 177 | WP_001586605.1 | DUF957 domain-containing protein | - |
| PT284_RS23265 (4643463) | 4643463..4643612 | + | 150 | Protein_4395 | hypothetical protein | - |
| PT284_RS23270 (4644268) | 4644268..4647159 | + | 2892 | WP_000580534.1 | SNF2-related protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | fimB / fimE | 4636081..4662226 | 26145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T272510 WP_000854765.1 NZ_CP117959:4642302-4642676 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT272510 WP_001540478.1 NZ_CP117959:4641844-4642212 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|