Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 36127..36686 Replicon plasmid unnamed1
Accession NZ_CP117958
Organism Escherichia coli strain B-2207

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag PT284_RS00200 Protein ID WP_000421272.1
Coordinates 36127..36402 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PT284_RS00205 Protein ID WP_102360527.1
Coordinates 36402..36686 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT284_RS00165 (32177) 32177..32917 - 741 WP_001066953.1 tyrosine-type recombinase/integrase -
PT284_RS00170 (33038) 33038..33220 - 183 WP_042344623.1 hypothetical protein -
PT284_RS00175 (33287) 33287..33576 - 290 Protein_34 type II toxin-antitoxin system RelE/ParE family toxin -
PT284_RS00180 (33563) 33563..33831 - 269 Protein_35 type II toxin-antitoxin system ParD family antitoxin -
PT284_RS00185 (34363) 34363..35532 + 1170 WP_001072355.1 hypothetical protein -
PT284_RS00190 (35565) 35565..35693 + 129 Protein_37 IS481 family transposase -
PT284_RS00195 (35818) 35818..36021 - 204 Protein_38 hypothetical protein -
PT284_RS00200 (36127) 36127..36402 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT284_RS00205 (36402) 36402..36686 - 285 WP_102360527.1 ribbon-helix-helix domain-containing protein Antitoxin
PT284_RS00210 (37291) 37291..38043 + 753 WP_001403368.1 IclR family transcriptional regulator -
PT284_RS00215 (38089) 38089..39054 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
PT284_RS00220 (39087) 39087..39467 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
PT284_RS00225 (39640) 39640..40518 + 879 WP_000338039.1 sugar ABC transporter permease -
PT284_RS00230 (40508) 40508..41395 + 888 WP_001271561.1 carbohydrate ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucB / iucC / iucD / iutA 1..122293 122293


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T272482 WP_000421272.1 NZ_CP117958:c36402-36127 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10432.81 Da        Isoelectric Point: 5.6558

>AT272482 WP_102360527.1 NZ_CP117958:c36686-36402 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPAPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure

References