Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8561..9204 Replicon plasmid unnamed1
Accession NZ_CP117958
Organism Escherichia coli strain B-2207

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag PT284_RS00055 Protein ID WP_001034044.1
Coordinates 8788..9204 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag PT284_RS00050 Protein ID WP_001261286.1
Coordinates 8561..8791 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT284_RS00020 (4071) 4071..4376 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PT284_RS00025 (4378) 4378..4596 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PT284_RS00030 (5188) 5188..5676 + 489 WP_011254646.1 hypothetical protein -
PT284_RS00035 (5710) 5710..6843 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
PT284_RS00040 (7010) 7010..7783 - 774 WP_000905949.1 hypothetical protein -
PT284_RS00045 (7796) 7796..8296 - 501 WP_102360530.1 HEPN family nuclease -
PT284_RS00050 (8561) 8561..8791 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PT284_RS00055 (8788) 8788..9204 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
PT284_RS00060 (9279) 9279..10844 + 1566 WP_001128474.1 AAA family ATPase -
PT284_RS00065 (10829) 10829..11851 + 1023 WP_000361402.1 helicase UvrD -
PT284_RS00075 (13158) 13158..14072 + 915 WP_000949004.1 iron/manganese ABC transporter substrate-binding protein SitA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucB / iucC / iucD / iutA 1..122293 122293
- flank IS/Tn sitABCD - 12105..16607 4502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T272481 WP_001034044.1 NZ_CP117958:8788-9204 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT272481 WP_001261286.1 NZ_CP117958:8561-8791 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References