Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-DinJ |
Location | 1217412..1217964 | Replicon | chromosome |
Accession | NZ_CP117956 | ||
Organism | Bifidobacterium adolescentis strain LMG 10502 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A1X2ZBV4 |
Locus tag | PT259_RS05325 | Protein ID | WP_011743342.1 |
Coordinates | 1217412..1217732 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A087DRE9 |
Locus tag | PT259_RS05330 | Protein ID | WP_033494219.1 |
Coordinates | 1217719..1217964 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT259_RS05295 | 1212512..1212793 | + | 282 | WP_041777341.1 | type II toxin-antitoxin system YafQ family toxin | - |
PT259_RS05300 | 1212812..1213009 | - | 198 | WP_041777342.1 | hypothetical protein | - |
PT259_RS05305 | 1213113..1215251 | - | 2139 | WP_011743338.1 | DUF2075 domain-containing protein | - |
PT259_RS05310 | 1215311..1215634 | + | 324 | WP_039198631.1 | nucleotide pyrophosphohydrolase | - |
PT259_RS05315 | 1216086..1216970 | + | 885 | WP_085379702.1 | Abi family protein | - |
PT259_RS05320 | 1217062..1217415 | - | 354 | WP_011743341.1 | nucleotidyltransferase domain-containing protein | - |
PT259_RS05325 | 1217412..1217732 | - | 321 | WP_011743342.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PT259_RS05330 | 1217719..1217964 | - | 246 | WP_033494219.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PT259_RS05335 | 1218383..1219003 | + | 621 | WP_231836951.1 | hypothetical protein | - |
PT259_RS05340 | 1219021..1219677 | - | 657 | WP_041777344.1 | ECF transporter S component | - |
PT259_RS05345 | 1219974..1220747 | - | 774 | WP_011743347.1 | GNAT family N-acetyltransferase | - |
PT259_RS05350 | 1220906..1221658 | + | 753 | WP_011743348.1 | YdcF family protein | - |
PT259_RS05355 | 1221690..1222313 | - | 624 | WP_011743349.1 | 3'-5' exonuclease | - |
PT259_RS05360 | 1222370..1222615 | - | 246 | WP_011743350.1 | homocysteine S-methyltransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11848.88 Da Isoelectric Point: 7.1665
>T272476 WP_011743342.1 NZ_CP117956:c1217732-1217412 [Bifidobacterium adolescentis]
MRRGEIWTVLADGYARKPRPVVVVQNDEIEGFDSTVVCLMISFTSDDMTTRVKVPPTAQNGLIKISWVMTEKILAVHTSA
LGQRIGILEDDVMRQVEKKLAHVLAL
MRRGEIWTVLADGYARKPRPVVVVQNDEIEGFDSTVVCLMISFTSDDMTTRVKVPPTAQNGLIKISWVMTEKILAVHTSA
LGQRIGILEDDVMRQVEKKLAHVLAL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X2ZBV4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087DRE9 |