Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafQ-relB/YafQ-DinJ |
| Location | 1212259..1212793 | Replicon | chromosome |
| Accession | NZ_CP117956 | ||
| Organism | Bifidobacterium adolescentis strain LMG 10502 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A1X2ZBX5 |
| Locus tag | PT259_RS05295 | Protein ID | WP_041777341.1 |
| Coordinates | 1212512..1212793 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1V8QB77 |
| Locus tag | PT259_RS05290 | Protein ID | WP_041777340.1 |
| Coordinates | 1212259..1212519 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT259_RS05275 | 1208286..1210061 | + | 1776 | WP_011743335.1 | glycoside hydrolase family 13 protein | - |
| PT259_RS05280 | 1210115..1211482 | + | 1368 | WP_011743336.1 | ABC transporter substrate-binding protein | - |
| PT259_RS05285 | 1211601..1212065 | + | 465 | WP_041777339.1 | D-aminoacyl-tRNA deacylase | - |
| PT259_RS05290 | 1212259..1212519 | + | 261 | WP_041777340.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PT259_RS05295 | 1212512..1212793 | + | 282 | WP_041777341.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PT259_RS05300 | 1212812..1213009 | - | 198 | WP_041777342.1 | hypothetical protein | - |
| PT259_RS05305 | 1213113..1215251 | - | 2139 | WP_011743338.1 | DUF2075 domain-containing protein | - |
| PT259_RS05310 | 1215311..1215634 | + | 324 | WP_039198631.1 | nucleotide pyrophosphohydrolase | - |
| PT259_RS05315 | 1216086..1216970 | + | 885 | WP_085379702.1 | Abi family protein | - |
| PT259_RS05320 | 1217062..1217415 | - | 354 | WP_011743341.1 | nucleotidyltransferase domain-containing protein | - |
| PT259_RS05325 | 1217412..1217732 | - | 321 | WP_011743342.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11090.90 Da Isoelectric Point: 10.2491
>T272475 WP_041777341.1 NZ_CP117956:1212512-1212793 [Bifidobacterium adolescentis]
MLKSVFRTTQFKKDFKVLLKKHYSPDKLKQAIDALMAQNKQLLSTKYRDHPLTGNWKGYREIHIEGDWLVIYRVEKQELQ
LVLTRTGSHDDLF
MLKSVFRTTQFKKDFKVLLKKHYSPDKLKQAIDALMAQNKQLLSTKYRDHPLTGNWKGYREIHIEGDWLVIYRVEKQELQ
LVLTRTGSHDDLF
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X2ZBX5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V8QB77 |