Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1275869..1276786 | Replicon | chromosome |
Accession | NZ_CP117945 | ||
Organism | Bacillus velezensis strain ZY1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | PT966_RS06720 | Protein ID | WP_072588210.1 |
Coordinates | 1276040..1276786 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PT966_RS06715 | Protein ID | WP_003154807.1 |
Coordinates | 1275869..1276039 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT966_RS06675 (PT966_06675) | 1271100..1272722 | + | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
PT966_RS06680 (PT966_06680) | 1272735..1273106 | + | 372 | WP_014304856.1 | XkdW family protein | - |
PT966_RS06685 (PT966_06685) | 1273112..1273309 | + | 198 | WP_003154819.1 | XkdX family protein | - |
PT966_RS06690 (PT966_06690) | 1273366..1274127 | + | 762 | WP_046559521.1 | hypothetical protein | - |
PT966_RS06695 (PT966_06695) | 1274179..1274442 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
PT966_RS06700 (PT966_06700) | 1274456..1274719 | + | 264 | WP_003154813.1 | phage holin | - |
PT966_RS06705 (PT966_06705) | 1274733..1275611 | + | 879 | WP_014304858.1 | N-acetylmuramoyl-L-alanine amidase | - |
PT966_RS06710 (PT966_06710) | 1275647..1275772 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PT966_RS06715 (PT966_06715) | 1275869..1276039 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PT966_RS06720 (PT966_06720) | 1276040..1276786 | - | 747 | WP_072588210.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PT966_RS06725 (PT966_06725) | 1276891..1277889 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PT966_RS06730 (PT966_06730) | 1277902..1278519 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PT966_RS06735 (PT966_06735) | 1278805..1280121 | - | 1317 | WP_003154801.1 | amino acid permease | - |
PT966_RS06740 (PT966_06740) | 1280445..1281395 | + | 951 | WP_024085196.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29033.52 Da Isoelectric Point: 4.7755
>T272474 WP_072588210.1 NZ_CP117945:c1276786-1276040 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CNYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CNYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|