Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4730267..4730859 | Replicon | chromosome |
| Accession | NZ_CP117886 | ||
| Organism | Serratia ureilytica strain KML.E1 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | PTZ17_RS22465 | Protein ID | WP_089197523.1 |
| Coordinates | 4730509..4730859 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | PTZ17_RS22460 | Protein ID | WP_089197522.1 |
| Coordinates | 4730267..4730515 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ17_RS22440 (PTZ17_22440) | 4726085..4726423 | + | 339 | WP_025304525.1 | PTS lactose/cellobiose transporter subunit IIA | - |
| PTZ17_RS22445 (PTZ17_22445) | 4726420..4727727 | + | 1308 | WP_033645265.1 | 6-phospho-beta-glucosidase | - |
| PTZ17_RS22450 (PTZ17_22450) | 4727800..4728780 | + | 981 | WP_033645266.1 | LacI family DNA-binding transcriptional regulator | - |
| PTZ17_RS22455 (PTZ17_22455) | 4728972..4730156 | + | 1185 | WP_060660175.1 | MFS transporter TsgA | - |
| PTZ17_RS22460 (PTZ17_22460) | 4730267..4730515 | + | 249 | WP_089197522.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PTZ17_RS22465 (PTZ17_22465) | 4730509..4730859 | + | 351 | WP_089197523.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| PTZ17_RS22470 (PTZ17_22470) | 4730856..4732139 | - | 1284 | WP_060441380.1 | cytosine deaminase | - |
| PTZ17_RS22475 (PTZ17_22475) | 4732428..4734977 | + | 2550 | WP_206195783.1 | nitrite reductase large subunit NirB | - |
| PTZ17_RS22480 (PTZ17_22480) | 4734974..4735300 | + | 327 | WP_019456155.1 | nitrite reductase small subunit NirD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12390.38 Da Isoelectric Point: 11.5657
>T272470 WP_089197523.1 NZ_CP117886:4730509-4730859 [Serratia ureilytica]
MVKRPVFQRGDLIRVSLNPVVGREQQGDFRPALVLSPREFNALGMVLVAPISQGANFARTAGFTVSLSGSGTATQGVILI
NQVRMMDLAGRSAQFVERAPGEVIADALARLQAIID
MVKRPVFQRGDLIRVSLNPVVGREQQGDFRPALVLSPREFNALGMVLVAPISQGANFARTAGFTVSLSGSGTATQGVILI
NQVRMMDLAGRSAQFVERAPGEVIADALARLQAIID
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|