Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4185724..4186393 | Replicon | chromosome |
| Accession | NZ_CP117886 | ||
| Organism | Serratia ureilytica strain KML.E1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PTZ17_RS19920 | Protein ID | WP_016929976.1 |
| Coordinates | 4185724..4186146 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | PTZ17_RS19925 | Protein ID | WP_004931679.1 |
| Coordinates | 4186127..4186393 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ17_RS19900 (PTZ17_19900) | 4181613..4182131 | + | 519 | WP_033635825.1 | flavodoxin FldB | - |
| PTZ17_RS19905 (PTZ17_19905) | 4182169..4183533 | - | 1365 | WP_033652165.1 | cell envelope integrity protein CreD | - |
| PTZ17_RS19910 (PTZ17_19910) | 4183614..4185032 | - | 1419 | WP_160204551.1 | two-component system sensor histidine kinase CreC | - |
| PTZ17_RS19915 (PTZ17_19915) | 4185029..4185724 | - | 696 | WP_047573795.1 | two-component system response regulator CreB | - |
| PTZ17_RS19920 (PTZ17_19920) | 4185724..4186146 | - | 423 | WP_016929976.1 | protein YgfX | Toxin |
| PTZ17_RS19925 (PTZ17_19925) | 4186127..4186393 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| PTZ17_RS19930 (PTZ17_19930) | 4186714..4187706 | + | 993 | WP_176589383.1 | tRNA-modifying protein YgfZ | - |
| PTZ17_RS19935 (PTZ17_19935) | 4187745..4188242 | - | 498 | WP_110147385.1 | DUF2165 domain-containing protein | - |
| PTZ17_RS19940 (PTZ17_19940) | 4188393..4189067 | - | 675 | WP_033644772.1 | hemolysin III family protein | - |
| PTZ17_RS19945 (PTZ17_19945) | 4189251..4189859 | + | 609 | WP_004931670.1 | HD domain-containing protein | - |
| PTZ17_RS19950 (PTZ17_19950) | 4189900..4190826 | - | 927 | WP_176589382.1 | ribokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16501.62 Da Isoelectric Point: 11.2159
>T272468 WP_016929976.1 NZ_CP117886:c4186146-4185724 [Serratia ureilytica]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGNGEEP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLHPPAGNGEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|