Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1694311..1694836 Replicon chromosome
Accession NZ_CP117886
Organism Serratia ureilytica strain KML.E1

Toxin (Protein)


Gene name relE Uniprot ID A0A8B4GJ35
Locus tag PTZ17_RS08150 Protein ID WP_033633469.1
Coordinates 1694311..1694595 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A8B4GIN1
Locus tag PTZ17_RS08155 Protein ID WP_004928423.1
Coordinates 1694585..1694836 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ17_RS08125 (PTZ17_08125) 1689515..1690648 + 1134 WP_069100891.1 putrescine ABC transporter ATP-binding subunit PotG -
PTZ17_RS08130 (PTZ17_08130) 1690673..1691635 + 963 WP_042784087.1 putrescine ABC transporter permease PotH -
PTZ17_RS08135 (PTZ17_08135) 1691632..1692477 + 846 WP_042784088.1 putrescine ABC transporter permease PotI -
PTZ17_RS08140 (PTZ17_08140) 1692639..1693118 + 480 WP_047024958.1 YbjO family protein -
PTZ17_RS08145 (PTZ17_08145) 1693187..1694314 + 1128 WP_122004040.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
PTZ17_RS08150 (PTZ17_08150) 1694311..1694595 - 285 WP_033633469.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PTZ17_RS08155 (PTZ17_08155) 1694585..1694836 - 252 WP_004928423.1 prevent-host-death protein Antitoxin
PTZ17_RS08160 (PTZ17_08160) 1694938..1695672 - 735 WP_015377297.1 arginine ABC transporter substrate-binding protein -
PTZ17_RS08165 (PTZ17_08165) 1695871..1696539 - 669 WP_099783622.1 arginine ABC transporter permease ArtM -
PTZ17_RS08170 (PTZ17_08170) 1696539..1697255 - 717 WP_025159684.1 arginine ABC transporter permease ArtQ -
PTZ17_RS08175 (PTZ17_08175) 1697265..1697996 - 732 WP_033642533.1 arginine ABC transporter substrate-binding protein -
PTZ17_RS08180 (PTZ17_08180) 1698029..1698757 - 729 WP_089192582.1 arginine ABC transporter ATP-binding protein ArtP -
PTZ17_RS08185 (PTZ17_08185) 1699022..1699564 - 543 WP_033642535.1 lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10789.91 Da        Isoelectric Point: 10.6941

>T272462 WP_033633469.1 NZ_CP117886:c1694595-1694311 [Serratia ureilytica]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.39 Da        Isoelectric Point: 4.5203

>AT272462 WP_004928423.1 NZ_CP117886:c1694836-1694585 [Serratia ureilytica]
MTVQPILADSAVSISDFKKSPNAALKEAQGQPVAVLTNGKISGYYVSPETWEAIAEYLEDIELAEIVRSRMNGKRIKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4GJ35

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4GIN1

References