Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1694311..1694836 | Replicon | chromosome |
| Accession | NZ_CP117886 | ||
| Organism | Serratia ureilytica strain KML.E1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8B4GJ35 |
| Locus tag | PTZ17_RS08150 | Protein ID | WP_033633469.1 |
| Coordinates | 1694311..1694595 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8B4GIN1 |
| Locus tag | PTZ17_RS08155 | Protein ID | WP_004928423.1 |
| Coordinates | 1694585..1694836 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ17_RS08125 (PTZ17_08125) | 1689515..1690648 | + | 1134 | WP_069100891.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
| PTZ17_RS08130 (PTZ17_08130) | 1690673..1691635 | + | 963 | WP_042784087.1 | putrescine ABC transporter permease PotH | - |
| PTZ17_RS08135 (PTZ17_08135) | 1691632..1692477 | + | 846 | WP_042784088.1 | putrescine ABC transporter permease PotI | - |
| PTZ17_RS08140 (PTZ17_08140) | 1692639..1693118 | + | 480 | WP_047024958.1 | YbjO family protein | - |
| PTZ17_RS08145 (PTZ17_08145) | 1693187..1694314 | + | 1128 | WP_122004040.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| PTZ17_RS08150 (PTZ17_08150) | 1694311..1694595 | - | 285 | WP_033633469.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTZ17_RS08155 (PTZ17_08155) | 1694585..1694836 | - | 252 | WP_004928423.1 | prevent-host-death protein | Antitoxin |
| PTZ17_RS08160 (PTZ17_08160) | 1694938..1695672 | - | 735 | WP_015377297.1 | arginine ABC transporter substrate-binding protein | - |
| PTZ17_RS08165 (PTZ17_08165) | 1695871..1696539 | - | 669 | WP_099783622.1 | arginine ABC transporter permease ArtM | - |
| PTZ17_RS08170 (PTZ17_08170) | 1696539..1697255 | - | 717 | WP_025159684.1 | arginine ABC transporter permease ArtQ | - |
| PTZ17_RS08175 (PTZ17_08175) | 1697265..1697996 | - | 732 | WP_033642533.1 | arginine ABC transporter substrate-binding protein | - |
| PTZ17_RS08180 (PTZ17_08180) | 1698029..1698757 | - | 729 | WP_089192582.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| PTZ17_RS08185 (PTZ17_08185) | 1699022..1699564 | - | 543 | WP_033642535.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10789.91 Da Isoelectric Point: 10.6941
>T272462 WP_033633469.1 NZ_CP117886:c1694595-1694311 [Serratia ureilytica]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GJ35 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GIN1 |