Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1557379..1557926 | Replicon | chromosome |
Accession | NZ_CP117886 | ||
Organism | Serratia ureilytica strain KML.E1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A380ADA6 |
Locus tag | PTZ17_RS07555 | Protein ID | WP_025302144.1 |
Coordinates | 1557618..1557926 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PTZ17_RS07550 | Protein ID | WP_025302143.1 |
Coordinates | 1557379..1557615 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ17_RS07535 (PTZ17_07535) | 1553865..1555400 | + | 1536 | WP_182073871.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
PTZ17_RS07540 (PTZ17_07540) | 1555453..1556373 | + | 921 | WP_025302141.1 | glutathione ABC transporter permease GsiC | - |
PTZ17_RS07545 (PTZ17_07545) | 1556383..1557291 | + | 909 | WP_015377211.1 | glutathione ABC transporter permease GsiD | - |
PTZ17_RS07550 (PTZ17_07550) | 1557379..1557615 | + | 237 | WP_025302143.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PTZ17_RS07555 (PTZ17_07555) | 1557618..1557926 | + | 309 | WP_025302144.1 | CcdB family protein | Toxin |
PTZ17_RS07560 (PTZ17_07560) | 1557963..1558805 | - | 843 | WP_015377214.1 | S-formylglutathione hydrolase | - |
PTZ17_RS07565 (PTZ17_07565) | 1558820..1559944 | - | 1125 | WP_033642438.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
PTZ17_RS07570 (PTZ17_07570) | 1559975..1560895 | - | 921 | WP_016928453.1 | LysR family transcriptional regulator | - |
PTZ17_RS07575 (PTZ17_07575) | 1561001..1562158 | + | 1158 | WP_033650593.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11504.32 Da Isoelectric Point: 5.0196
>T272461 WP_025302144.1 NZ_CP117886:1557618-1557926 [Serratia ureilytica]
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|