Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1081377..1081999 Replicon chromosome
Accession NZ_CP117886
Organism Serratia ureilytica strain KML.E1

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag PTZ17_RS05155 Protein ID WP_004940313.1
Coordinates 1081377..1081580 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag PTZ17_RS05160 Protein ID WP_004940312.1
Coordinates 1081631..1081999 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ17_RS05125 (PTZ17_05125) 1077185..1077649 + 465 WP_033651100.1 type II secretion system protein GspM -
PTZ17_RS05130 (PTZ17_05130) 1077776..1077943 + 168 Protein_981 prepilin peptidase -
PTZ17_RS05135 (PTZ17_05135) 1077974..1078480 + 507 WP_274256613.1 A24 family peptidase -
PTZ17_RS05140 (PTZ17_05140) 1078477..1078839 - 363 WP_052752709.1 type II secretion system pilot lipoprotein GspS -
PTZ17_RS05145 (PTZ17_05145) 1079097..1080524 + 1428 WP_197788495.1 N-acetylglucosamine-binding protein GbpA -
PTZ17_RS05150 (PTZ17_05150) 1080577..1081095 + 519 WP_033651103.1 cytochrome b/b6 domain-containing protein -
PTZ17_RS05155 (PTZ17_05155) 1081377..1081580 - 204 WP_004940313.1 HHA domain-containing protein Toxin
PTZ17_RS05160 (PTZ17_05160) 1081631..1081999 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
PTZ17_RS05165 (PTZ17_05165) 1082159..1082512 - 354 WP_047572432.1 hypothetical protein -
PTZ17_RS05170 (PTZ17_05170) 1082920..1083633 + 714 WP_069100193.1 ABC transporter ATP-binding protein -
PTZ17_RS05175 (PTZ17_05175) 1083630..1084487 + 858 WP_047572431.1 metal ABC transporter permease -
PTZ17_RS05180 (PTZ17_05180) 1084513..1085391 + 879 WP_033642106.1 metal ABC transporter substrate-binding protein -
PTZ17_RS05185 (PTZ17_05185) 1085497..1085637 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
PTZ17_RS05190 (PTZ17_05190) 1085650..1085904 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T272460 WP_004940313.1 NZ_CP117886:c1081580-1081377 [Serratia ureilytica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT272460 WP_004940312.1 NZ_CP117886:c1081999-1081631 [Serratia ureilytica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References