Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1081377..1081999 | Replicon | chromosome |
| Accession | NZ_CP117886 | ||
| Organism | Serratia ureilytica strain KML.E1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
| Locus tag | PTZ17_RS05155 | Protein ID | WP_004940313.1 |
| Coordinates | 1081377..1081580 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
| Locus tag | PTZ17_RS05160 | Protein ID | WP_004940312.1 |
| Coordinates | 1081631..1081999 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ17_RS05125 (PTZ17_05125) | 1077185..1077649 | + | 465 | WP_033651100.1 | type II secretion system protein GspM | - |
| PTZ17_RS05130 (PTZ17_05130) | 1077776..1077943 | + | 168 | Protein_981 | prepilin peptidase | - |
| PTZ17_RS05135 (PTZ17_05135) | 1077974..1078480 | + | 507 | WP_274256613.1 | A24 family peptidase | - |
| PTZ17_RS05140 (PTZ17_05140) | 1078477..1078839 | - | 363 | WP_052752709.1 | type II secretion system pilot lipoprotein GspS | - |
| PTZ17_RS05145 (PTZ17_05145) | 1079097..1080524 | + | 1428 | WP_197788495.1 | N-acetylglucosamine-binding protein GbpA | - |
| PTZ17_RS05150 (PTZ17_05150) | 1080577..1081095 | + | 519 | WP_033651103.1 | cytochrome b/b6 domain-containing protein | - |
| PTZ17_RS05155 (PTZ17_05155) | 1081377..1081580 | - | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
| PTZ17_RS05160 (PTZ17_05160) | 1081631..1081999 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
| PTZ17_RS05165 (PTZ17_05165) | 1082159..1082512 | - | 354 | WP_047572432.1 | hypothetical protein | - |
| PTZ17_RS05170 (PTZ17_05170) | 1082920..1083633 | + | 714 | WP_069100193.1 | ABC transporter ATP-binding protein | - |
| PTZ17_RS05175 (PTZ17_05175) | 1083630..1084487 | + | 858 | WP_047572431.1 | metal ABC transporter permease | - |
| PTZ17_RS05180 (PTZ17_05180) | 1084513..1085391 | + | 879 | WP_033642106.1 | metal ABC transporter substrate-binding protein | - |
| PTZ17_RS05185 (PTZ17_05185) | 1085497..1085637 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| PTZ17_RS05190 (PTZ17_05190) | 1085650..1085904 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T272460 WP_004940313.1 NZ_CP117886:c1081580-1081377 [Serratia ureilytica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT272460 WP_004940312.1 NZ_CP117886:c1081999-1081631 [Serratia ureilytica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4G7F9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2G5J9 |