Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 14142..14743 | Replicon | chromosome |
Accession | NZ_CP117886 | ||
Organism | Serratia ureilytica strain KML.E1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A8B4GSJ7 |
Locus tag | PTZ17_RS00065 | Protein ID | WP_025304766.1 |
Coordinates | 14142..14522 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8B4GSF3 |
Locus tag | PTZ17_RS00070 | Protein ID | WP_025304767.1 |
Coordinates | 14522..14743 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ17_RS00040 (PTZ17_00040) | 9389..10669 | + | 1281 | WP_033652318.1 | DUF3748 domain-containing protein | - |
PTZ17_RS00045 (PTZ17_00045) | 10700..11047 | - | 348 | WP_016929593.1 | YceK/YidQ family lipoprotein | - |
PTZ17_RS00050 (PTZ17_00050) | 11357..11770 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
PTZ17_RS00055 (PTZ17_00055) | 11877..12305 | + | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
PTZ17_RS00060 (PTZ17_00060) | 12473..14131 | + | 1659 | WP_033652317.1 | putative transporter | - |
PTZ17_RS00065 (PTZ17_00065) | 14142..14522 | - | 381 | WP_025304766.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTZ17_RS00070 (PTZ17_00070) | 14522..14743 | - | 222 | WP_025304767.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PTZ17_RS00075 (PTZ17_00075) | 14817..16067 | - | 1251 | WP_033645138.1 | valine--pyruvate transaminase | - |
PTZ17_RS00080 (PTZ17_00080) | 17070..17849 | + | 780 | WP_033645137.1 | 2OG-Fe dioxygenase family protein | - |
PTZ17_RS00085 (PTZ17_00085) | 17929..19068 | + | 1140 | WP_046687995.1 | PLP-dependent aspartate aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14241.66 Da Isoelectric Point: 7.3173
>T272458 WP_025304766.1 NZ_CP117886:c14522-14142 [Serratia ureilytica]
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GSJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GSF3 |