Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2136681..2137340 | Replicon | chromosome |
Accession | NZ_CP117884 | ||
Organism | Lacticaseibacillus sp. KACC 23028 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PQ472_RS10500 | Protein ID | WP_274259674.1 |
Coordinates | 2137158..2137340 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PQ472_RS10495 | Protein ID | WP_274259673.1 |
Coordinates | 2136681..2137139 (-) | Length | 153 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ472_RS10470 (PQ472_10470) | 2132840..2133712 | + | 873 | WP_274259668.1 | hypothetical protein | - |
PQ472_RS10475 (PQ472_10475) | 2133911..2134570 | + | 660 | WP_274259669.1 | hypothetical protein | - |
PQ472_RS10480 (PQ472_10480) | 2134696..2134827 | - | 132 | WP_274259670.1 | hypothetical protein | - |
PQ472_RS10485 (PQ472_10485) | 2135095..2135952 | - | 858 | WP_274259671.1 | TPM domain-containing protein | - |
PQ472_RS10490 (PQ472_10490) | 2135961..2136554 | - | 594 | WP_274262280.1 | LemA family protein | - |
PQ472_RS10495 (PQ472_10495) | 2136681..2137139 | - | 459 | WP_274259673.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PQ472_RS10500 (PQ472_10500) | 2137158..2137340 | - | 183 | WP_274259674.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PQ472_RS10505 (PQ472_10505) | 2137473..2137955 | - | 483 | WP_274259676.1 | AAA family ATPase | - |
PQ472_RS10510 (PQ472_10510) | 2138105..2139046 | - | 942 | WP_274259678.1 | dihydroorotate oxidase | - |
PQ472_RS10515 (PQ472_10515) | 2139030..2140286 | - | 1257 | WP_274259680.1 | MFS transporter | - |
PQ472_RS10520 (PQ472_10520) | 2140567..2141298 | + | 732 | WP_274259682.1 | orotidine-5'-phosphate decarboxylase | - |
PQ472_RS10525 (PQ472_10525) | 2141291..2141932 | + | 642 | WP_274259684.1 | orotate phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6666.90 Da Isoelectric Point: 12.0707
>T272457 WP_274259674.1 NZ_CP117884:c2137340-2137158 [Lacticaseibacillus sp. KACC 23028]
VPMTQRQMVRLLMKNGWFKTGGGKGSHIKMAKAGKRPITVPHGELRQPTENAIRKQAGIE
VPMTQRQMVRLLMKNGWFKTGGGKGSHIKMAKAGKRPITVPHGELRQPTENAIRKQAGIE
Download Length: 183 bp
Antitoxin
Download Length: 153 a.a. Molecular weight: 17051.11 Da Isoelectric Point: 4.5141
>AT272457 WP_274259673.1 NZ_CP117884:c2137139-2136681 [Lacticaseibacillus sp. KACC 23028]
MFVTYPAYFYYSKQDAVHFFVTFPDFNLSATQGTDVADAMYMASDWLGINVADLVEHERALPTPSAMGELSLTDNPFFND
DADLRSSFDATQSFVSMVGVNIDSYLNQSQPIKKTLTIPKWANDRGKKLHINFSETLTEAIANLPNPHSLQK
MFVTYPAYFYYSKQDAVHFFVTFPDFNLSATQGTDVADAMYMASDWLGINVADLVEHERALPTPSAMGELSLTDNPFFND
DADLRSSFDATQSFVSMVGVNIDSYLNQSQPIKKTLTIPKWANDRGKKLHINFSETLTEAIANLPNPHSLQK
Download Length: 459 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|