Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-relB/YoeB-RelB |
| Location | 1010904..1011420 | Replicon | chromosome |
| Accession | NZ_CP117883 | ||
| Organism | Mucilaginibacter sp. KACC 22773 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | PQ469_RS04365 | Protein ID | WP_274211875.1 |
| Coordinates | 1011160..1011420 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PQ469_RS04360 | Protein ID | WP_274211874.1 |
| Coordinates | 1010904..1011158 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ469_RS04350 (PQ469_04350) | 1006940..1008160 | + | 1221 | WP_274211872.1 | serpin family protein | - |
| PQ469_RS04355 (PQ469_04355) | 1008271..1010739 | - | 2469 | WP_274211873.1 | M1 family metallopeptidase | - |
| PQ469_RS04360 (PQ469_04360) | 1010904..1011158 | + | 255 | WP_274211874.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PQ469_RS04365 (PQ469_04365) | 1011160..1011420 | + | 261 | WP_274211875.1 | Txe/YoeB family addiction module toxin | Toxin |
| PQ469_RS04370 (PQ469_04370) | 1011498..1012919 | - | 1422 | WP_274211876.1 | C45 family peptidase | - |
| PQ469_RS04375 (PQ469_04375) | 1013472..1014089 | + | 618 | WP_090643368.1 | 50S ribosomal protein L3 | - |
| PQ469_RS04380 (PQ469_04380) | 1014091..1014723 | + | 633 | WP_090643371.1 | 50S ribosomal protein L4 | - |
| PQ469_RS04385 (PQ469_04385) | 1014726..1015016 | + | 291 | WP_090643376.1 | 50S ribosomal protein L23 | - |
| PQ469_RS04390 (PQ469_04390) | 1015025..1015852 | + | 828 | WP_090643381.1 | 50S ribosomal protein L2 | - |
| PQ469_RS04395 (PQ469_04395) | 1015852..1016118 | + | 267 | WP_076377419.1 | 30S ribosomal protein S19 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10385.06 Da Isoelectric Point: 9.5318
>T272456 WP_274211875.1 NZ_CP117883:1011160-1011420 [Mucilaginibacter sp. KACC 22773]
MELVWQTQGWDDYLHWQQADKKVMERINALIKECLRSPFKGIGKPEPLKGNFAGCWSRRITDEHRLIYKVKDGRLHILQC
RYHYQI
MELVWQTQGWDDYLHWQQADKKVMERINALIKECLRSPFKGIGKPEPLKGNFAGCWSRRITDEHRLIYKVKDGRLHILQC
RYHYQI
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|