272455

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 2555502..2556100 Replicon chromosome
Accession NZ_CP117881
Organism Novosphingobium sp. KACC 22771

Toxin (Protein)


Gene name brnT Uniprot ID -
Locus tag PQ467_RS11715 Protein ID WP_274173580.1
Coordinates 2555502..2555828 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID -
Locus tag PQ467_RS11720 Protein ID WP_274173581.1
Coordinates 2555825..2556100 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQ467_RS11670 (PQ467_11670) 2551592..2552371 + 780 WP_274173571.1 phage terminase small subunit -
PQ467_RS11675 (PQ467_11675) 2552368..2552565 + 198 WP_274173572.1 hypothetical protein -
PQ467_RS11680 (PQ467_11680) 2552680..2553162 + 483 WP_274173573.1 head completion/stabilization protein -
PQ467_RS11685 (PQ467_11685) 2553162..2553383 + 222 WP_274173574.1 hypothetical protein -
PQ467_RS11690 (PQ467_11690) 2553380..2553598 + 219 WP_274173575.1 tail protein X -
PQ467_RS11695 (PQ467_11695) 2553603..2553794 - 192 WP_274173576.1 hypothetical protein -
PQ467_RS11700 (PQ467_11700) 2553880..2554356 + 477 WP_274173577.1 phage tail protein -
PQ467_RS11705 (PQ467_11705) 2554366..2554839 + 474 WP_274173578.1 phage virion morphogenesis protein -
PQ467_RS11710 (PQ467_11710) 2554858..2555319 - 462 WP_274173579.1 hypothetical protein -
PQ467_RS11715 (PQ467_11715) 2555502..2555828 + 327 WP_274173580.1 BrnT family toxin Toxin
PQ467_RS11720 (PQ467_11720) 2555825..2556100 + 276 WP_274173581.1 BrnA antitoxin family protein Antitoxin
PQ467_RS11725 (PQ467_11725) 2556164..2556676 + 513 WP_274173582.1 hypothetical protein -
PQ467_RS11730 (PQ467_11730) 2557023..2557637 - 615 WP_274173583.1 hypothetical protein -
PQ467_RS11735 (PQ467_11735) 2557696..2558004 - 309 WP_274173584.1 DUF5658 family protein -
PQ467_RS11740 (PQ467_11740) 2558049..2558660 - 612 WP_274173585.1 lysozyme -
PQ467_RS11745 (PQ467_11745) 2558650..2558886 - 237 WP_274173586.1 hypothetical protein -
PQ467_RS11750 (PQ467_11750) 2558873..2559088 - 216 WP_274173587.1 hypothetical protein -
PQ467_RS11755 (PQ467_11755) 2559296..2559616 + 321 WP_274173588.1 hypothetical protein -
PQ467_RS11760 (PQ467_11760) 2559664..2559924 - 261 WP_274173589.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2537967..2577171 39204


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(32-103)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(16-88)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11991.02 Da        Isoelectric Point: 10.0913

>T272455 WP_274173580.1 NZ_CP117881:2555502-2555828 [Novosphingobium sp. KACC 22771]
MRKNLASVNRYYNLRLTPIQIVTTENPMMIVWDEPKREANILKHGIDFADIGEGFFASALIGQAKAGRWFAIGEMDGVIV
VIFATLGTEGISIISARPASRKERKLIA

Download         Length: 327 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 9773.20 Da        Isoelectric Point: 9.9500

>AT272455 WP_274173581.1 NZ_CP117881:2555825-2556100 [Novosphingobium sp. KACC 22771]
MTKAKFTKADMDAVSDSPELTAEDIAAARPFAEVFPEMAAKMRATRGAQKAPTKVSTTIRLSPEVIAHFKAGGSGWQARI
DAALKEWVASH

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References