Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 1949716..1950266 | Replicon | chromosome |
Accession | NZ_CP117881 | ||
Organism | Novosphingobium sp. KACC 22771 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PQ467_RS08885 | Protein ID | WP_274173087.1 |
Coordinates | 1949964..1950266 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | PQ467_RS08880 | Protein ID | WP_274173086.1 |
Coordinates | 1949716..1949961 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ467_RS08860 (PQ467_08860) | 1945253..1946031 | + | 779 | Protein_1743 | SDR family oxidoreductase | - |
PQ467_RS08865 (PQ467_08865) | 1946461..1948161 | - | 1701 | WP_274173084.1 | hypothetical protein | - |
PQ467_RS08870 (PQ467_08870) | 1948164..1948541 | - | 378 | WP_274173085.1 | hypothetical protein | - |
PQ467_RS08875 (PQ467_08875) | 1948878..1949515 | - | 638 | Protein_1746 | tyrosine-type recombinase/integrase | - |
PQ467_RS08880 (PQ467_08880) | 1949716..1949961 | + | 246 | WP_274173086.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
PQ467_RS08885 (PQ467_08885) | 1949964..1950266 | + | 303 | WP_274173087.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQ467_RS08890 (PQ467_08890) | 1950641..1951096 | + | 456 | WP_274173088.1 | hypothetical protein | - |
PQ467_RS08895 (PQ467_08895) | 1951463..1952809 | + | 1347 | WP_274173089.1 | hypothetical protein | - |
PQ467_RS08900 (PQ467_08900) | 1952806..1953321 | + | 516 | WP_274173090.1 | hypothetical protein | - |
PQ467_RS08905 (PQ467_08905) | 1953318..1955243 | + | 1926 | WP_274173091.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1948164..1960660 | 12496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11272.70 Da Isoelectric Point: 4.8401
>T272454 WP_274173087.1 NZ_CP117881:1949964-1950266 [Novosphingobium sp. KACC 22771]
VPRFQLTRAAADDLTAIFLEGIEQFGLPQADAYHEGLSAIFAFLADYPHAARLREEISPPVRVHPYKAHLVIYDVGAEDE
VIILRVRHGREDWISSNFDG
VPRFQLTRAAADDLTAIFLEGIEQFGLPQADAYHEGLSAIFAFLADYPHAARLREEISPPVRVHPYKAHLVIYDVGAEDE
VIILRVRHGREDWISSNFDG
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|