Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 4063575..4064210 | Replicon | chromosome |
| Accession | NZ_CP117876 | ||
| Organism | Paenibacillus sp. KACC 21273 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1E3L8D9 |
| Locus tag | PQ460_RS17920 | Protein ID | WP_069326106.1 |
| Coordinates | 4063575..4063925 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PQ460_RS17925 | Protein ID | WP_069326107.1 |
| Coordinates | 4063929..4064210 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ460_RS17905 (PQ460_17905) | 4059928..4060413 | - | 486 | WP_274170638.1 | SprT family protein | - |
| PQ460_RS17910 (PQ460_17910) | 4060545..4060910 | + | 366 | WP_274170639.1 | hydrolase/acyltransferase | - |
| PQ460_RS17915 (PQ460_17915) | 4061156..4063381 | - | 2226 | WP_274170640.1 | Tex family protein | - |
| PQ460_RS17920 (PQ460_17920) | 4063575..4063925 | - | 351 | WP_069326106.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQ460_RS17925 (PQ460_17925) | 4063929..4064210 | - | 282 | WP_069326107.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PQ460_RS17930 (PQ460_17930) | 4064433..4065626 | - | 1194 | WP_273616255.1 | alanine racemase | - |
| PQ460_RS17935 (PQ460_17935) | 4065869..4066534 | - | 666 | WP_274170641.1 | hypothetical protein | - |
| PQ460_RS17940 (PQ460_17940) | 4066602..4067357 | - | 756 | WP_273615299.1 | hypothetical protein | - |
| PQ460_RS17945 (PQ460_17945) | 4067359..4068615 | - | 1257 | WP_274170642.1 | SPFH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12927.91 Da Isoelectric Point: 6.4842
>T272451 WP_069326106.1 NZ_CP117876:c4063925-4063575 [Paenibacillus sp. KACC 21273]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRRVHDALQISLGLVEF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRRVHDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|