Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4792249..4792784 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PSR30_RS21515 | Protein ID | WP_039533010.1 |
Coordinates | 4792497..4792784 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q6DB37 |
Locus tag | PSR30_RS21510 | Protein ID | WP_010281712.1 |
Coordinates | 4792249..4792500 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS21490 (PSR30_21490) | 4788218..4789351 | + | 1134 | WP_274214576.1 | alkylhydroperoxidase domain protein | - |
PSR30_RS21495 (PSR30_21495) | 4789394..4790017 | - | 624 | WP_040035577.1 | LysE family translocator | - |
PSR30_RS21500 (PSR30_21500) | 4790296..4791051 | + | 756 | WP_274214577.1 | thiol:disulfide interchange protein DsbG | - |
PSR30_RS21505 (PSR30_21505) | 4791086..4791991 | - | 906 | WP_274214578.1 | siderophore-interacting protein | - |
PSR30_RS21510 (PSR30_21510) | 4792249..4792500 | + | 252 | WP_010281712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PSR30_RS21515 (PSR30_21515) | 4792497..4792784 | + | 288 | WP_039533010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSR30_RS21520 (PSR30_21520) | 4792887..4794239 | - | 1353 | WP_040032226.1 | glutathione-disulfide reductase | - |
PSR30_RS21525 (PSR30_21525) | 4794368..4795210 | - | 843 | WP_039363917.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
PSR30_RS21530 (PSR30_21530) | 4795429..4796157 | + | 729 | WP_040032224.1 | DUF1266 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11128.20 Da Isoelectric Point: 10.2532
>T272450 WP_039533010.1 NZ_CP117874:4792497-4792784 [Pectobacterium carotovorum subsp. carotovorum]
MSYRVKFREDALKEWLKLDKTIQQQFAKKLKECCENPHIPAAKLRGMKDCYKIKLRASGFRLVYEVIDDVLIIAVVAVGK
RERSGVYHLASERMR
MSYRVKFREDALKEWLKLDKTIQQQFAKKLKECCENPHIPAAKLRGMKDCYKIKLRASGFRLVYEVIDDVLIIAVVAVGK
RERSGVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|