Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3378548..3379273 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | PSR30_RS15185 | Protein ID | WP_274214161.1 |
Coordinates | 3378953..3379273 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PSR30_RS15180 | Protein ID | WP_274214160.1 |
Coordinates | 3378548..3378883 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS15145 (PSR30_15145) | 3373580..3374374 | + | 795 | WP_274214154.1 | hypothetical protein | - |
PSR30_RS15150 (PSR30_15150) | 3374497..3375372 | + | 876 | WP_274214155.1 | GTPase family protein | - |
PSR30_RS15155 (PSR30_15155) | 3375742..3376440 | + | 699 | WP_274214156.1 | DeoR family transcriptional regulator | - |
PSR30_RS15160 (PSR30_15160) | 3376538..3377191 | + | 654 | WP_274214157.1 | hypothetical protein | - |
PSR30_RS15165 (PSR30_15165) | 3377227..3377700 | + | 474 | WP_274214158.1 | hypothetical protein | - |
PSR30_RS15170 (PSR30_15170) | 3377717..3377950 | + | 234 | WP_039494636.1 | membrane protein | - |
PSR30_RS15175 (PSR30_15175) | 3378035..3378502 | + | 468 | WP_274214159.1 | DNA repair protein RadC | - |
PSR30_RS15180 (PSR30_15180) | 3378548..3378883 | + | 336 | WP_274214160.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PSR30_RS15185 (PSR30_15185) | 3378953..3379273 | + | 321 | WP_274214161.1 | TA system toxin CbtA family protein | Toxin |
PSR30_RS15190 (PSR30_15190) | 3379391..3380224 | + | 834 | WP_274214162.1 | DUF4942 domain-containing protein | - |
PSR30_RS15195 (PSR30_15195) | 3380785..3383169 | + | 2385 | WP_274214163.1 | dynamin family protein | - |
PSR30_RS15200 (PSR30_15200) | 3383166..3384071 | + | 906 | WP_274214164.1 | diguanylate cyclase regulator RdcB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12045.77 Da Isoelectric Point: 4.7768
>T272448 WP_274214161.1 NZ_CP117874:3378953-3379273 [Pectobacterium carotovorum subsp. carotovorum]
MQTSPAIPPREDNPCPSPIAVWQQLLTYLLEKHYGLTLNDTPLCEENVIQEHIDAGVTLVNTVNFLVEKYELVRIDRNGF
NWQEQSPFLTAVDVLRARRATGLLKA
MQTSPAIPPREDNPCPSPIAVWQQLLTYLLEKHYGLTLNDTPLCEENVIQEHIDAGVTLVNTVNFLVEKYELVRIDRNGF
NWQEQSPFLTAVDVLRARRATGLLKA
Download Length: 321 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12308.99 Da Isoelectric Point: 6.4640
>AT272448 WP_274214160.1 NZ_CP117874:3378548-3378883 [Pectobacterium carotovorum subsp. carotovorum]
MPSSDTPEWGLKCAVTPHFGARLVQEGHRLHYLADRASIVGTFSKTVAQSLERCFPELIKQLEQKLRTGELNPRQQGCVT
LHCNEWTCEADTLGSVGYVYIVIYPSSAAAE
MPSSDTPEWGLKCAVTPHFGARLVQEGHRLHYLADRASIVGTFSKTVAQSLERCFPELIKQLEQKLRTGELNPRQQGCVT
LHCNEWTCEADTLGSVGYVYIVIYPSSAAAE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|