Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1740035..1740588 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A1V2R684 |
Locus tag | PSR30_RS07710 | Protein ID | WP_039360030.1 |
Coordinates | 1740274..1740588 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A837DPD8 |
Locus tag | PSR30_RS07705 | Protein ID | WP_039473880.1 |
Coordinates | 1740035..1740271 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS07695 (PSR30_07695) | 1736843..1738714 | - | 1872 | WP_039473476.1 | AAA family ATPase | - |
PSR30_RS07700 (PSR30_07700) | 1739484..1739874 | + | 391 | Protein_1498 | ArdC family protein | - |
PSR30_RS07705 (PSR30_07705) | 1740035..1740271 | + | 237 | WP_039473880.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PSR30_RS07710 (PSR30_07710) | 1740274..1740588 | + | 315 | WP_039360030.1 | CcdB family protein | Toxin |
PSR30_RS07720 (PSR30_07720) | 1741250..1742047 | - | 798 | WP_010307981.1 | DgsA anti-repressor MtfA | - |
PSR30_RS07730 (PSR30_07730) | 1742289..1742675 | - | 387 | WP_274215176.1 | lysozyme inhibitor LprI family protein | - |
PSR30_RS07735 (PSR30_07735) | 1742746..1742887 | - | 142 | Protein_1503 | IS5/IS1182 family transposase | - |
PSR30_RS07740 (PSR30_07740) | 1743062..1744483 | - | 1422 | WP_274215177.1 | hypothetical protein | - |
PSR30_RS07745 (PSR30_07745) | 1744620..1744853 | + | 234 | WP_274215178.1 | hypothetical protein | - |
PSR30_RS07750 (PSR30_07750) | 1744908..1745330 | + | 423 | WP_274215179.1 | DUF2946 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1716286..1744853 | 28567 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11535.48 Da Isoelectric Point: 7.9859
>T272446 WP_039360030.1 NZ_CP117874:1740274-1740588 [Pectobacterium carotovorum subsp. carotovorum]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R684 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837DPD8 |