Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1267097..1267722 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | C6DB72 |
Locus tag | PSR30_RS05660 | Protein ID | WP_005976087.1 |
Coordinates | 1267097..1267300 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | C6DB73 |
Locus tag | PSR30_RS05665 | Protein ID | WP_005976089.1 |
Coordinates | 1267354..1267722 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS05630 (PSR30_05630) | 1262558..1262896 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
PSR30_RS05635 (PSR30_05635) | 1262936..1264222 | + | 1287 | WP_039472387.1 | ammonium transporter AmtB | - |
PSR30_RS05640 (PSR30_05640) | 1264357..1265220 | - | 864 | WP_010303014.1 | acyl-CoA thioesterase II | - |
PSR30_RS05645 (PSR30_05645) | 1265433..1266014 | + | 582 | WP_010303016.1 | YbaY family lipoprotein | - |
PSR30_RS05650 (PSR30_05650) | 1266034..1266354 | - | 321 | WP_010282239.1 | MGMT family protein | - |
PSR30_RS05660 (PSR30_05660) | 1267097..1267300 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
PSR30_RS05665 (PSR30_05665) | 1267354..1267722 | - | 369 | WP_005976089.1 | Hha toxicity modulator TomB | Antitoxin |
PSR30_RS05670 (PSR30_05670) | 1268321..1268464 | - | 144 | WP_005976091.1 | type B 50S ribosomal protein L36 | - |
PSR30_RS05675 (PSR30_05675) | 1268482..1268730 | - | 249 | WP_039472395.1 | type B 50S ribosomal protein L31 | - |
PSR30_RS05680 (PSR30_05680) | 1268961..1272089 | - | 3129 | WP_274215013.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T272444 WP_005976087.1 NZ_CP117874:c1267300-1267097 [Pectobacterium carotovorum subsp. carotovorum]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14032.77 Da Isoelectric Point: 4.4787
>AT272444 WP_005976089.1 NZ_CP117874:c1267722-1267354 [Pectobacterium carotovorum subsp. carotovorum]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3F0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3G5 |