Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 735701..736361 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PSR30_RS03315 | Protein ID | WP_010301815.1 |
Coordinates | 735987..736361 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A1D7Z1Z6 |
Locus tag | PSR30_RS03310 | Protein ID | WP_005971623.1 |
Coordinates | 735701..735967 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS03290 (PSR30_03290) | 731603..732607 | - | 1005 | WP_138254842.1 | LacI family DNA-binding transcriptional regulator | - |
PSR30_RS03295 (PSR30_03295) | 732662..733270 | - | 609 | WP_274214817.1 | HD domain-containing protein | - |
PSR30_RS03300 (PSR30_03300) | 733549..734196 | + | 648 | WP_039539856.1 | hemolysin III family protein | - |
PSR30_RS03305 (PSR30_03305) | 734464..735465 | - | 1002 | WP_274214818.1 | tRNA-modifying protein YgfZ | - |
PSR30_RS03310 (PSR30_03310) | 735701..735967 | + | 267 | WP_005971623.1 | FAD assembly factor SdhE | Antitoxin |
PSR30_RS03315 (PSR30_03315) | 735987..736361 | + | 375 | WP_010301815.1 | protein YgfX | Toxin |
PSR30_RS03320 (PSR30_03320) | 736430..737365 | + | 936 | WP_240819903.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
PSR30_RS03325 (PSR30_03325) | 737431..737754 | - | 324 | WP_010301820.1 | hypothetical protein | - |
PSR30_RS03330 (PSR30_03330) | 737783..738301 | - | 519 | WP_010301821.1 | flavodoxin FldB | - |
PSR30_RS03335 (PSR30_03335) | 738641..739027 | - | 387 | WP_039534581.1 | thioesterase family protein | - |
PSR30_RS03340 (PSR30_03340) | 739235..740563 | - | 1329 | WP_274214819.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14654.33 Da Isoelectric Point: 10.5560
>T272443 WP_010301815.1 NZ_CP117874:735987-736361 [Pectobacterium carotovorum subsp. carotovorum]
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQILLQQKHWAR
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQILLQQKHWAR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|