Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
Location | 360477..361008 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A7V8PTM5 |
Locus tag | PSR30_RS01620 | Protein ID | WP_039470363.1 |
Coordinates | 360721..361008 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A3R8PFZ6 |
Locus tag | PSR30_RS01615 | Protein ID | WP_039470361.1 |
Coordinates | 360477..360731 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS01590 (PSR30_01590) | 355934..356524 | - | 591 | WP_005975525.1 | DnaA initiator-associating protein DiaA | - |
PSR30_RS01595 (PSR30_01595) | 356588..356944 | - | 357 | WP_274215411.1 | YraN family protein | - |
PSR30_RS01600 (PSR30_01600) | 356941..358959 | - | 2019 | WP_039547218.1 | penicillin-binding protein activator | - |
PSR30_RS01605 (PSR30_01605) | 359021..359908 | + | 888 | WP_039470360.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
PSR30_RS01615 (PSR30_01615) | 360477..360731 | + | 255 | WP_039470361.1 | plasmid stabilization protein | Antitoxin |
PSR30_RS01620 (PSR30_01620) | 360721..361008 | + | 288 | WP_039470363.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSR30_RS01625 (PSR30_01625) | 361185..361970 | + | 786 | WP_039547220.1 | 4,5-DOPA dioxygenase extradiol | - |
PSR30_RS01630 (PSR30_01630) | 362038..363198 | - | 1161 | WP_010297418.1 | glutathionylspermidine synthase family protein | - |
PSR30_RS01635 (PSR30_01635) | 363209..363883 | - | 675 | WP_010297420.1 | DUF1190 family protein | - |
PSR30_RS01640 (PSR30_01640) | 364150..365544 | - | 1395 | WP_040031843.1 | outer membrane channel protein TolC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10974.88 Da Isoelectric Point: 10.6713
>T272438 WP_039470363.1 NZ_CP117874:360721-361008 [Pectobacterium carotovorum subsp. carotovorum]
MTYKLKFVPSALKEWKKLGHPVREQFKKKLVERLENPHVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQIYSDTKGRSA
MTYKLKFVPSALKEWKKLGHPVREQFKKKLVERLENPHVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQIYSDTKGRSA
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8PTM5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8PFZ6 |