Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 196434..197051 | Replicon | chromosome |
| Accession | NZ_CP117874 | ||
| Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | C6DHN3 |
| Locus tag | PSR30_RS00840 | Protein ID | WP_010281507.1 |
| Coordinates | 196872..197051 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PSR30_RS00835 | Protein ID | WP_274214674.1 |
| Coordinates | 196434..196844 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR30_RS00820 (PSR30_00820) | 192298..193341 | - | 1044 | WP_039363341.1 | DNA-binding transcriptional regulator CytR | - |
| PSR30_RS00825 (PSR30_00825) | 193651..195849 | - | 2199 | WP_039535645.1 | primosomal protein N' | - |
| PSR30_RS00830 (PSR30_00830) | 196122..196337 | + | 216 | WP_010281510.1 | 50S ribosomal protein L31 | - |
| PSR30_RS00835 (PSR30_00835) | 196434..196844 | - | 411 | WP_274214674.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PSR30_RS00840 (PSR30_00840) | 196872..197051 | - | 180 | WP_010281507.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PSR30_RS00845 (PSR30_00845) | 197150..198160 | - | 1011 | WP_180781350.1 | iron ABC transporter permease | - |
| PSR30_RS00850 (PSR30_00850) | 198157..199119 | - | 963 | WP_180781351.1 | ABC transporter substrate-binding protein | - |
| PSR30_RS00855 (PSR30_00855) | 199129..199926 | - | 798 | WP_039535641.1 | ABC transporter ATP-binding protein | - |
| PSR30_RS00860 (PSR30_00860) | 200145..200462 | - | 318 | WP_005973355.1 | met regulon transcriptional regulator MetJ | - |
| PSR30_RS00865 (PSR30_00865) | 200650..201810 | + | 1161 | WP_010299271.1 | cystathionine gamma-synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6560.69 Da Isoelectric Point: 10.7838
>T272437 WP_010281507.1 NZ_CP117874:c197051-196872 [Pectobacterium carotovorum subsp. carotovorum]
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14546.50 Da Isoelectric Point: 4.5502
>AT272437 WP_274214674.1 NZ_CP117874:c196844-196434 [Pectobacterium carotovorum subsp. carotovorum]
MFYPIAIEAGDKTHAYGVTVPDLPGCFSAGDTLDDAIANAKEAITGHIELLIEMGQDIPTVSSVGQLAKNAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
MFYPIAIEAGDKTHAYGVTVPDLPGCFSAGDTLDDAIANAKEAITGHIELLIEMGQDIPTVSSVGQLAKNAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|