Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 134200..134951 | Replicon | chromosome |
Accession | NZ_CP117874 | ||
Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PSR30_RS00565 | Protein ID | WP_125233253.1 |
Coordinates | 134469..134951 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | PSR30_RS00560 | Protein ID | WP_125233370.1 |
Coordinates | 134200..134478 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR30_RS00535 (PSR30_00535) | 129704..130360 | - | 657 | WP_274214654.1 | aldolase | - |
PSR30_RS00540 (PSR30_00540) | 130357..131631 | - | 1275 | WP_274214655.1 | four-carbon acid sugar kinase family protein | - |
PSR30_RS00545 (PSR30_00545) | 131628..132542 | - | 915 | WP_249649106.1 | NAD(P)-dependent oxidoreductase | - |
PSR30_RS00550 (PSR30_00550) | 132881..133642 | + | 762 | WP_010303245.1 | DNA-binding transcriptional repressor YgbI | - |
PSR30_RS00555 (PSR30_00555) | 133655..134089 | + | 435 | WP_274214656.1 | hypothetical protein | - |
PSR30_RS00560 (PSR30_00560) | 134200..134478 | + | 279 | WP_125233370.1 | DUF1778 domain-containing protein | Antitoxin |
PSR30_RS00565 (PSR30_00565) | 134469..134951 | + | 483 | WP_125233253.1 | GNAT family N-acetyltransferase | Toxin |
PSR30_RS00570 (PSR30_00570) | 135084..136418 | + | 1335 | WP_274214657.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PSR30_RS00575 (PSR30_00575) | 136491..137378 | + | 888 | WP_010303217.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PSR30_RS00580 (PSR30_00580) | 137375..138220 | + | 846 | WP_039491922.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PSR30_RS00585 (PSR30_00585) | 138246..139319 | + | 1074 | WP_010303211.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17391.21 Da Isoelectric Point: 9.3654
>T272436 WP_125233253.1 NZ_CP117874:134469-134951 [Pectobacterium carotovorum subsp. carotovorum]
MGITAPGPLSAGHNLAEFCSQEPSLNEWLKKKALKNHSAGISRVYVICAEGTHQVIGYYCLSTGSVQRNTAPGAYRRNAP
ESLPVIVLGRLAIDQAYSGKGLGVALLKDAIFRTENIALQVGVRALVVHALDENVRNFYLKFAFDPSPVQPLMLLYPIKI
MGITAPGPLSAGHNLAEFCSQEPSLNEWLKKKALKNHSAGISRVYVICAEGTHQVIGYYCLSTGSVQRNTAPGAYRRNAP
ESLPVIVLGRLAIDQAYSGKGLGVALLKDAIFRTENIALQVGVRALVVHALDENVRNFYLKFAFDPSPVQPLMLLYPIKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|