Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2360604..2361120 Replicon chromosome
Accession NZ_CP117863
Organism Novacetimonas hansenii strain NQ5

Toxin (Protein)


Gene name relE Uniprot ID A0A7U7KN46
Locus tag LV563_RS10150 Protein ID WP_062809681.1
Coordinates 2360604..2360888 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7U7KNI3
Locus tag LV563_RS10155 Protein ID WP_062809680.1
Coordinates 2360878..2361120 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV563_RS10125 (LV563_10125) 2356344..2356763 + 420 WP_064305451.1 hypothetical protein -
LV563_RS10130 (LV563_10130) 2357078..2357476 + 399 WP_147317864.1 hypothetical protein -
LV563_RS10135 (LV563_10135) 2357476..2359224 + 1749 WP_147317866.1 hypothetical protein -
LV563_RS10140 (LV563_10140) 2359296..2360039 - 744 WP_081254528.1 Flp family type IVb pilin -
LV563_RS10145 (LV563_10145) 2360200..2360391 - 192 WP_081254542.1 Flp family type IVb pilin -
LV563_RS10150 (LV563_10150) 2360604..2360888 - 285 WP_062809681.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LV563_RS10155 (LV563_10155) 2360878..2361120 - 243 WP_062809680.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LV563_RS10160 (LV563_10160) 2361225..2362223 - 999 WP_064305449.1 AAA family ATPase -
LV563_RS10165 (LV563_10165) 2362646..2363191 + 546 WP_062809679.1 hypothetical protein -
LV563_RS10170 (LV563_10170) 2363188..2363814 + 627 WP_062809678.1 recombinase family protein -
LV563_RS10175 (LV563_10175) 2364408..2364896 + 489 WP_147317868.1 hypothetical protein -
LV563_RS10180 (LV563_10180) 2364965..2365678 + 714 WP_075595501.1 LuxR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2347063..2367291 20228


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(2-79)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11068.65 Da        Isoelectric Point: 9.5908

>T272434 WP_062809681.1 NZ_CP117863:c2360888-2360604 [Novacetimonas hansenii]
MTYEIAFERRALDEWNALDGSVRQQFKKKLQKLQDNPQAGQALHGELTGYYKIKLRKSGYRLVYEILNEEIVIFVITVGK
REDSEVYETAKNRK

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9388.01 Da        Isoelectric Point: 9.7560

>AT272434 WP_062809680.1 NZ_CP117863:c2361120-2360878 [Novacetimonas hansenii]
MLTQVSYKIPQDMKDEAYAVLKSMGIKPSDAIRDYFAYIVKNRDTPVKKELMSAEDREILAIIRERKKNPQMVRVRLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U7KN46

Antitoxin

Source ID Structure
AlphaFold DB A0A7U7KNI3

References