Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 76303..76841 Replicon plasmid pKOB3
Accession NZ_CP117862
Organism Komagataeibacter oboediens strain NCIB 8034

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag LV478_RS19010 Protein ID WP_176644214.1
Coordinates 76518..76841 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A850P707
Locus tag LV478_RS19005 Protein ID WP_034931143.1
Coordinates 76303..76521 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV478_RS18965 (LV478_18980) 71539..72489 + 951 WP_275879419.1 replication initiator protein A -
LV478_RS18970 (LV478_18985) 73302..73481 + 180 WP_019087453.1 type II toxin-antitoxin system HicA family toxin -
LV478_RS18975 (LV478_18990) 73492..73908 + 417 WP_010518062.1 type II toxin-antitoxin system HicB family antitoxin -
LV478_RS18980 (LV478_18995) 74349..74594 + 246 WP_029329817.1 plasmid stabilization protein -
LV478_RS18985 (LV478_19000) 74591..74776 + 186 WP_010518059.1 PilT protein -
LV478_RS18990 (LV478_19005) 74839..75156 + 318 WP_275879420.1 hypothetical protein -
LV478_RS18995 (LV478_19010) 75050..75577 + 528 WP_275879421.1 hypothetical protein -
LV478_RS19000 (LV478_19015) 75670..76065 + 396 WP_176644213.1 DUF2442 domain-containing protein -
LV478_RS19005 (LV478_19020) 76303..76521 + 219 WP_034931143.1 antitoxin MazE family protein Antitoxin
LV478_RS19010 (LV478_19025) 76518..76841 + 324 WP_176644214.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
LV478_RS19015 (LV478_19030) 76871..77146 - 276 WP_275879422.1 hypothetical protein -
LV478_RS19020 (LV478_19035) 77195..77440 + 246 WP_010518373.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
LV478_RS19025 (LV478_19040) 77437..77823 + 387 WP_025439964.1 type II toxin-antitoxin system VapC family toxin -
LV478_RS19030 (LV478_19045) 77867..79927 - 2061 WP_275879423.1 phospholipase D family protein -
LV478_RS19035 (LV478_19050) 80179..80610 - 432 WP_232276075.1 hypothetical protein -
LV478_RS19040 (LV478_19055) 81064..81465 - 402 Protein_104 transposase -
LV478_RS19045 (LV478_19060) 81577..81789 + 213 WP_019092610.1 DUF4160 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97332 97332
- flank IS/Tn - - 81064..81291 227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(7-70)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11574.65 Da        Isoelectric Point: 8.6364

>T272433 WP_176644214.1 NZ_CP117862:76518-76841 [Komagataeibacter oboediens]
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA

Download         Length: 324 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8033.20 Da        Isoelectric Point: 6.9786

>AT272433 WP_034931143.1 NZ_CP117862:76303-76521 [Komagataeibacter oboediens]
MTPVAIRVKKRRDTLRKAGLRPVQIWVPDTRAKGFDEECRRQAMLVALADSHDPDIASFLDAAAADLDGWEA

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A850P707

References