Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 76303..76841 | Replicon | plasmid pKOB3 |
| Accession | NZ_CP117862 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LV478_RS19010 | Protein ID | WP_176644214.1 |
| Coordinates | 76518..76841 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A850P707 |
| Locus tag | LV478_RS19005 | Protein ID | WP_034931143.1 |
| Coordinates | 76303..76521 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS18965 (LV478_18980) | 71539..72489 | + | 951 | WP_275879419.1 | replication initiator protein A | - |
| LV478_RS18970 (LV478_18985) | 73302..73481 | + | 180 | WP_019087453.1 | type II toxin-antitoxin system HicA family toxin | - |
| LV478_RS18975 (LV478_18990) | 73492..73908 | + | 417 | WP_010518062.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| LV478_RS18980 (LV478_18995) | 74349..74594 | + | 246 | WP_029329817.1 | plasmid stabilization protein | - |
| LV478_RS18985 (LV478_19000) | 74591..74776 | + | 186 | WP_010518059.1 | PilT protein | - |
| LV478_RS18990 (LV478_19005) | 74839..75156 | + | 318 | WP_275879420.1 | hypothetical protein | - |
| LV478_RS18995 (LV478_19010) | 75050..75577 | + | 528 | WP_275879421.1 | hypothetical protein | - |
| LV478_RS19000 (LV478_19015) | 75670..76065 | + | 396 | WP_176644213.1 | DUF2442 domain-containing protein | - |
| LV478_RS19005 (LV478_19020) | 76303..76521 | + | 219 | WP_034931143.1 | antitoxin MazE family protein | Antitoxin |
| LV478_RS19010 (LV478_19025) | 76518..76841 | + | 324 | WP_176644214.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LV478_RS19015 (LV478_19030) | 76871..77146 | - | 276 | WP_275879422.1 | hypothetical protein | - |
| LV478_RS19020 (LV478_19035) | 77195..77440 | + | 246 | WP_010518373.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| LV478_RS19025 (LV478_19040) | 77437..77823 | + | 387 | WP_025439964.1 | type II toxin-antitoxin system VapC family toxin | - |
| LV478_RS19030 (LV478_19045) | 77867..79927 | - | 2061 | WP_275879423.1 | phospholipase D family protein | - |
| LV478_RS19035 (LV478_19050) | 80179..80610 | - | 432 | WP_232276075.1 | hypothetical protein | - |
| LV478_RS19040 (LV478_19055) | 81064..81465 | - | 402 | Protein_104 | transposase | - |
| LV478_RS19045 (LV478_19060) | 81577..81789 | + | 213 | WP_019092610.1 | DUF4160 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97332 | 97332 | |
| - | flank | IS/Tn | - | - | 81064..81291 | 227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11574.65 Da Isoelectric Point: 8.6364
>T272433 WP_176644214.1 NZ_CP117862:76518-76841 [Komagataeibacter oboediens]
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|