Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 73302..73908 Replicon plasmid pKOB3
Accession NZ_CP117862
Organism Komagataeibacter oboediens strain NCIB 8034

Toxin (Protein)


Gene name hicA Uniprot ID A0A0D6QDX8
Locus tag LV478_RS18970 Protein ID WP_019087453.1
Coordinates 73302..73481 (+) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID W5YE06
Locus tag LV478_RS18975 Protein ID WP_010518062.1
Coordinates 73492..73908 (+) Length 139 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV478_RS18940 (LV478_18955) 68505..68801 + 297 WP_051672079.1 WGR domain-containing protein -
LV478_RS18945 (LV478_18960) 68798..69432 + 635 Protein_85 tyrosine-type recombinase/integrase -
LV478_RS18950 (LV478_18965) 69521..69775 + 255 WP_019092318.1 ribbon-helix-helix domain-containing protein -
LV478_RS18955 (LV478_18970) 69779..70198 + 420 WP_019092319.1 putative toxin-antitoxin system toxin component, PIN family -
LV478_RS18960 (LV478_18975) 70573..71226 + 654 WP_019092320.1 ParA family protein -
LV478_RS18965 (LV478_18980) 71539..72489 + 951 WP_275879419.1 replication initiator protein A -
LV478_RS18970 (LV478_18985) 73302..73481 + 180 WP_019087453.1 type II toxin-antitoxin system HicA family toxin Toxin
LV478_RS18975 (LV478_18990) 73492..73908 + 417 WP_010518062.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LV478_RS18980 (LV478_18995) 74349..74594 + 246 WP_029329817.1 plasmid stabilization protein -
LV478_RS18985 (LV478_19000) 74591..74776 + 186 WP_010518059.1 PilT protein -
LV478_RS18990 (LV478_19005) 74839..75156 + 318 WP_275879420.1 hypothetical protein -
LV478_RS18995 (LV478_19010) 75050..75577 + 528 WP_275879421.1 hypothetical protein -
LV478_RS19000 (LV478_19015) 75670..76065 + 396 WP_176644213.1 DUF2442 domain-containing protein -
LV478_RS19005 (LV478_19020) 76303..76521 + 219 WP_034931143.1 antitoxin MazE family protein -
LV478_RS19010 (LV478_19025) 76518..76841 + 324 WP_176644214.1 type II toxin-antitoxin system PemK/MazF family toxin -
LV478_RS19015 (LV478_19030) 76871..77146 - 276 WP_275879422.1 hypothetical protein -
LV478_RS19020 (LV478_19035) 77195..77440 + 246 WP_010518373.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
LV478_RS19025 (LV478_19040) 77437..77823 + 387 WP_025439964.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97332 97332


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-125)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6479.65 Da        Isoelectric Point: 11.4111

>T272432 WP_019087453.1 NZ_CP117862:73302-73481 [Komagataeibacter oboediens]
MKSADLIRELEKAGWKLDRVRGSHNVFKHPSRPGIVVVPHPKKDLGTGLVAAIRKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 139 a.a.        Molecular weight: 14857.70 Da        Isoelectric Point: 4.3147

>AT272432 WP_010518062.1 NZ_CP117862:73492-73908 [Komagataeibacter oboediens]
MRYPVVIERGSETTAFGVVFPDLPGCFSAGDTLDEAISNAEEAAAAWIDATLDAGEAVPSPSTLDAIQNNPDYEGWTVGF
VTIDPAVLDDRVERANISLPRRVLERLDALARSSHESRSGMIAAMTLQARLKPVVRSK

Download         Length: 417 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6QDX8

Antitoxin

Source ID Structure
AlphaFold DB A0A0D6QDJ4

References