Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 54753..55423 | Replicon | plasmid pKOB3 |
Accession | NZ_CP117862 | ||
Organism | Komagataeibacter oboediens strain NCIB 8034 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LV478_RS18880 | Protein ID | WP_275879407.1 |
Coordinates | 55001..55423 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LV478_RS18875 | Protein ID | WP_275879406.1 |
Coordinates | 54753..55004 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LV478_RS18850 (LV478_18865) | 50434..50817 | + | 384 | Protein_66 | recombinase family protein | - |
LV478_RS18855 (LV478_18870) | 50814..51593 | + | 780 | WP_035979553.1 | DUF4019 domain-containing protein | - |
LV478_RS18860 (LV478_18875) | 52888..53124 | + | 237 | WP_083824341.1 | DUF4160 domain-containing protein | - |
LV478_RS18865 (LV478_18880) | 53114..53521 | + | 408 | WP_099542224.1 | DUF2442 domain-containing protein | - |
LV478_RS18870 (LV478_18885) | 53835..54077 | + | 243 | WP_053324047.1 | BrnA antitoxin family protein | - |
LV478_RS18875 (LV478_18890) | 54753..55004 | + | 252 | WP_275879406.1 | plasmid stabilization protein | Antitoxin |
LV478_RS18880 (LV478_18895) | 55001..55423 | + | 423 | WP_275879407.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LV478_RS18885 (LV478_18900) | 55629..56360 | - | 732 | WP_275879408.1 | SprT family zinc-dependent metalloprotease | - |
LV478_RS18890 (LV478_18905) | 56360..59662 | - | 3303 | WP_275879409.1 | HsdR family type I site-specific deoxyribonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..97332 | 97332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15219.46 Da Isoelectric Point: 4.3712
>T272431 WP_275879407.1 NZ_CP117862:55001-55423 [Komagataeibacter oboediens]
MILLDTNVISEPWKPVPEPCVLDWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQEVLQERLEQDVLPLFKGRILSFDL
GASQAYAELMVQARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
MILLDTNVISEPWKPVPEPCVLDWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQEVLQERLEQDVLPLFKGRILSFDL
GASQAYAELMVQARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|