Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 39221..39902 Replicon plasmid pKOB3
Accession NZ_CP117862
Organism Komagataeibacter oboediens strain NCIB 8034

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LV478_RS18790 Protein ID WP_110531928.1
Coordinates 39221..39643 (+) Length 141 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID W5YD93
Locus tag LV478_RS18795 Protein ID WP_010512461.1
Coordinates 39708..39902 (+) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV478_RS18760 (LV478_18775) 34326..34685 - 360 WP_275879428.1 conjugal transfer protein TraD -
LV478_RS18765 (LV478_18780) 34782..37802 + 3021 WP_275879443.1 Ti-type conjugative transfer relaxase TraA -
LV478_RS18770 (LV478_18785) 37709..38158 + 450 WP_275879444.1 hypothetical protein -
LV478_RS18775 (LV478_18790) 38205..38627 + 423 WP_007396294.1 putative toxin-antitoxin system toxin component, PIN family -
LV478_RS18780 (LV478_18795) 38624..38887 + 264 WP_041250516.1 toxin-antitoxin system HicB family antitoxin -
LV478_RS18785 (LV478_18800) 38973..39224 + 252 WP_025439953.1 plasmid stabilization protein -
LV478_RS18790 (LV478_18805) 39221..39643 + 423 WP_110531928.1 type II toxin-antitoxin system VapC family toxin Toxin
LV478_RS18795 (LV478_18810) 39708..39902 + 195 WP_010512461.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LV478_RS18800 (LV478_18815) 39899..40291 + 393 WP_007396299.1 PIN domain nuclease -
LV478_RS18805 (LV478_18820) 40584..41252 + 669 WP_275879446.1 DUF6118 family protein -
LV478_RS18810 (LV478_18825) 41519..42160 + 642 WP_275879430.1 hypothetical protein -
LV478_RS18815 (LV478_18830) 42203..42610 - 408 WP_039736219.1 Rrf2 family transcriptional regulator -
LV478_RS18820 (LV478_18835) 42610..42879 - 270 WP_225063301.1 hypothetical protein -
LV478_RS18825 (LV478_18840) 43541..44173 + 633 WP_275879431.1 invasion associated locus B family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97332 97332


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-122)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-47)


Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 15266.54 Da        Isoelectric Point: 5.2273

>T272430 WP_110531928.1 NZ_CP117862:39221-39643 [Komagataeibacter oboediens]
MILLDTNVISEPWKPVPEPRVLAWIDGQAIETLFLSAVTVAELRFGIGAMPTGRRRSVLHERLEQEVLPLFAGRVLSFDL
AASQAYAELMVRARSEGRAIGKADGYIAATAASRGYVVASRDVSPFEAAGVRVLNPWEDT

Download         Length: 423 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7268.49 Da        Isoelectric Point: 10.4776

>AT272430 WP_010512461.1 NZ_CP117862:39708-39902 [Komagataeibacter oboediens]
MRTNIIIDDALMTDALKASGVKTKKEAVELGLRTLIRLKQQRELRTLRGKLDWQGDLDAMRSDA

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A318QDR0

References