Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 24583..25121 Replicon plasmid pKOB3
Accession NZ_CP117862
Organism Komagataeibacter oboediens strain NCIB 8034

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag LV478_RS18675 Protein ID WP_176644214.1
Coordinates 24798..25121 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A850P707
Locus tag LV478_RS18670 Protein ID WP_034931143.1
Coordinates 24583..24801 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV478_RS18635 (LV478_18650) 19818..20768 + 951 WP_082770868.1 replication initiator protein A -
LV478_RS18640 (LV478_18655) 21583..21762 + 180 WP_019087453.1 type II toxin-antitoxin system HicA family toxin -
LV478_RS18645 (LV478_18660) 21773..22189 + 417 WP_010518062.1 type II toxin-antitoxin system HicB family antitoxin -
LV478_RS18650 (LV478_18665) 22630..22875 + 246 WP_029329817.1 plasmid stabilization protein -
LV478_RS18655 (LV478_18670) 22872..23057 + 186 WP_010518059.1 PilT protein -
LV478_RS18660 (LV478_18675) 23081..23857 + 777 WP_275879439.1 hypothetical protein -
LV478_RS18665 (LV478_18680) 23950..24345 + 396 WP_176644213.1 DUF2442 domain-containing protein -
LV478_RS18670 (LV478_18685) 24583..24801 + 219 WP_034931143.1 antitoxin MazE family protein Antitoxin
LV478_RS18675 (LV478_18690) 24798..25121 + 324 WP_176644214.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
LV478_RS18680 (LV478_18695) 25151..25426 - 276 WP_275879422.1 hypothetical protein -
LV478_RS18685 (LV478_18700) 25475..25720 + 246 WP_010518373.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
LV478_RS18690 (LV478_18705) 25717..26103 + 387 WP_025439964.1 type II toxin-antitoxin system VapC family toxin -
LV478_RS18695 (LV478_18710) 26147..26431 - 285 WP_275879440.1 hypothetical protein -
LV478_RS18700 (LV478_18715) 26376..28208 - 1833 WP_275879441.1 phospholipase D family protein -
LV478_RS18705 (LV478_18720) 28460..28891 - 432 WP_232276075.1 hypothetical protein -
LV478_RS18710 (LV478_18725) 29344..29745 - 402 Protein_38 transposase -
LV478_RS18715 (LV478_18730) 29857..30069 + 213 WP_019092610.1 DUF4160 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97332 97332
- flank IS/Tn - - 29344..29571 227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(7-70)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11574.65 Da        Isoelectric Point: 8.6364

>T272428 WP_176644214.1 NZ_CP117862:24798-25121 [Komagataeibacter oboediens]
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA

Download         Length: 324 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8033.20 Da        Isoelectric Point: 6.9786

>AT272428 WP_034931143.1 NZ_CP117862:24583-24801 [Komagataeibacter oboediens]
MTPVAIRVKKRRDTLRKAGLRPVQIWVPDTRAKGFDEECRRQAMLVALADSHDPDIASFLDAAAADLDGWEA

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A850P707

References