Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 24583..25121 | Replicon | plasmid pKOB3 |
| Accession | NZ_CP117862 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LV478_RS18675 | Protein ID | WP_176644214.1 |
| Coordinates | 24798..25121 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A850P707 |
| Locus tag | LV478_RS18670 | Protein ID | WP_034931143.1 |
| Coordinates | 24583..24801 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS18635 (LV478_18650) | 19818..20768 | + | 951 | WP_082770868.1 | replication initiator protein A | - |
| LV478_RS18640 (LV478_18655) | 21583..21762 | + | 180 | WP_019087453.1 | type II toxin-antitoxin system HicA family toxin | - |
| LV478_RS18645 (LV478_18660) | 21773..22189 | + | 417 | WP_010518062.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| LV478_RS18650 (LV478_18665) | 22630..22875 | + | 246 | WP_029329817.1 | plasmid stabilization protein | - |
| LV478_RS18655 (LV478_18670) | 22872..23057 | + | 186 | WP_010518059.1 | PilT protein | - |
| LV478_RS18660 (LV478_18675) | 23081..23857 | + | 777 | WP_275879439.1 | hypothetical protein | - |
| LV478_RS18665 (LV478_18680) | 23950..24345 | + | 396 | WP_176644213.1 | DUF2442 domain-containing protein | - |
| LV478_RS18670 (LV478_18685) | 24583..24801 | + | 219 | WP_034931143.1 | antitoxin MazE family protein | Antitoxin |
| LV478_RS18675 (LV478_18690) | 24798..25121 | + | 324 | WP_176644214.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LV478_RS18680 (LV478_18695) | 25151..25426 | - | 276 | WP_275879422.1 | hypothetical protein | - |
| LV478_RS18685 (LV478_18700) | 25475..25720 | + | 246 | WP_010518373.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| LV478_RS18690 (LV478_18705) | 25717..26103 | + | 387 | WP_025439964.1 | type II toxin-antitoxin system VapC family toxin | - |
| LV478_RS18695 (LV478_18710) | 26147..26431 | - | 285 | WP_275879440.1 | hypothetical protein | - |
| LV478_RS18700 (LV478_18715) | 26376..28208 | - | 1833 | WP_275879441.1 | phospholipase D family protein | - |
| LV478_RS18705 (LV478_18720) | 28460..28891 | - | 432 | WP_232276075.1 | hypothetical protein | - |
| LV478_RS18710 (LV478_18725) | 29344..29745 | - | 402 | Protein_38 | transposase | - |
| LV478_RS18715 (LV478_18730) | 29857..30069 | + | 213 | WP_019092610.1 | DUF4160 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97332 | 97332 | |
| - | flank | IS/Tn | - | - | 29344..29571 | 227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11574.65 Da Isoelectric Point: 8.6364
>T272428 WP_176644214.1 NZ_CP117862:24798-25121 [Komagataeibacter oboediens]
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA
MKRGDFVTVALQDDLGKPQPALVVQADRFDMTAVVILLPLSSALVDAPLLRLTIRPDEYNGLRKPSQVMIDKPTTINREK
VGPAFGIASDTLMLSVSRALALFLGLA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|