Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 21583..22189 | Replicon | plasmid pKOB3 |
| Accession | NZ_CP117862 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0D6QDX8 |
| Locus tag | LV478_RS18640 | Protein ID | WP_019087453.1 |
| Coordinates | 21583..21762 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | W5YE06 |
| Locus tag | LV478_RS18645 | Protein ID | WP_010518062.1 |
| Coordinates | 21773..22189 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS18605 (LV478_18620) | 16782..17078 | + | 297 | WP_051672079.1 | WGR domain-containing protein | - |
| LV478_RS18610 (LV478_18625) | 17075..17710 | + | 636 | WP_176643954.1 | tyrosine-type recombinase/integrase | - |
| LV478_RS18615 (LV478_18630) | 17799..18053 | + | 255 | WP_019092318.1 | ribbon-helix-helix domain-containing protein | - |
| LV478_RS18620 (LV478_18635) | 18057..18476 | + | 420 | WP_019092319.1 | putative toxin-antitoxin system toxin component, PIN family | - |
| LV478_RS18625 (LV478_18640) | 18851..19504 | + | 654 | WP_019092320.1 | ParA family protein | - |
| LV478_RS18630 (LV478_18645) | 19501..19821 | + | 321 | WP_202898835.1 | hypothetical protein | - |
| LV478_RS18635 (LV478_18650) | 19818..20768 | + | 951 | WP_082770868.1 | replication initiator protein A | - |
| LV478_RS18640 (LV478_18655) | 21583..21762 | + | 180 | WP_019087453.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LV478_RS18645 (LV478_18660) | 21773..22189 | + | 417 | WP_010518062.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LV478_RS18650 (LV478_18665) | 22630..22875 | + | 246 | WP_029329817.1 | plasmid stabilization protein | - |
| LV478_RS18655 (LV478_18670) | 22872..23057 | + | 186 | WP_010518059.1 | PilT protein | - |
| LV478_RS18660 (LV478_18675) | 23081..23857 | + | 777 | WP_275879439.1 | hypothetical protein | - |
| LV478_RS18665 (LV478_18680) | 23950..24345 | + | 396 | WP_176644213.1 | DUF2442 domain-containing protein | - |
| LV478_RS18670 (LV478_18685) | 24583..24801 | + | 219 | WP_034931143.1 | antitoxin MazE family protein | - |
| LV478_RS18675 (LV478_18690) | 24798..25121 | + | 324 | WP_176644214.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LV478_RS18680 (LV478_18695) | 25151..25426 | - | 276 | WP_275879422.1 | hypothetical protein | - |
| LV478_RS18685 (LV478_18700) | 25475..25720 | + | 246 | WP_010518373.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| LV478_RS18690 (LV478_18705) | 25717..26103 | + | 387 | WP_025439964.1 | type II toxin-antitoxin system VapC family toxin | - |
| LV478_RS18695 (LV478_18710) | 26147..26431 | - | 285 | WP_275879440.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97332 | 97332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6479.65 Da Isoelectric Point: 11.4111
>T272427 WP_019087453.1 NZ_CP117862:21583-21762 [Komagataeibacter oboediens]
MKSADLIRELEKAGWKLDRVRGSHNVFKHPSRPGIVVVPHPKKDLGTGLVAAIRKQAGL
MKSADLIRELEKAGWKLDRVRGSHNVFKHPSRPGIVVVPHPKKDLGTGLVAAIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14857.70 Da Isoelectric Point: 4.3147
>AT272427 WP_010518062.1 NZ_CP117862:21773-22189 [Komagataeibacter oboediens]
MRYPVVIERGSETTAFGVVFPDLPGCFSAGDTLDEAISNAEEAAAAWIDATLDAGEAVPSPSTLDAIQNNPDYEGWTVGF
VTIDPAVLDDRVERANISLPRRVLERLDALARSSHESRSGMIAAMTLQARLKPVVRSK
MRYPVVIERGSETTAFGVVFPDLPGCFSAGDTLDEAISNAEEAAAAWIDATLDAGEAVPSPSTLDAIQNNPDYEGWTVGF
VTIDPAVLDDRVERANISLPRRVLERLDALARSSHESRSGMIAAMTLQARLKPVVRSK
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6QDX8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6QDJ4 |