Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 3033..3703 | Replicon | plasmid pKOB3 |
| Accession | NZ_CP117862 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LV478_RS18545 | Protein ID | WP_275879407.1 |
| Coordinates | 3281..3703 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LV478_RS18540 | Protein ID | WP_275879433.1 |
| Coordinates | 3033..3284 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS18525 (LV478_18540) | 1168..1404 | + | 237 | WP_083824341.1 | DUF4160 domain-containing protein | - |
| LV478_RS18530 (LV478_18545) | 1394..1801 | + | 408 | WP_099542224.1 | DUF2442 domain-containing protein | - |
| LV478_RS18535 (LV478_18550) | 2115..2357 | + | 243 | WP_053324047.1 | BrnA antitoxin family protein | - |
| LV478_RS18540 (LV478_18555) | 3033..3284 | + | 252 | WP_275879433.1 | plasmid stabilization protein | Antitoxin |
| LV478_RS18545 (LV478_18560) | 3281..3703 | + | 423 | WP_275879407.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LV478_RS18550 (LV478_18565) | 3909..4640 | - | 732 | WP_275879434.1 | SprT family zinc-dependent metalloprotease | - |
| LV478_RS18555 (LV478_18570) | 4640..7942 | - | 3303 | WP_275879409.1 | HsdR family type I site-specific deoxyribonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97332 | 97332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15219.46 Da Isoelectric Point: 4.3712
>T272426 WP_275879407.1 NZ_CP117862:3281-3703 [Komagataeibacter oboediens]
MILLDTNVISEPWKPVPEPCVLDWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQEVLQERLEQDVLPLFKGRILSFDL
GASQAYAELMVQARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
MILLDTNVISEPWKPVPEPCVLDWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQEVLQERLEQDVLPLFKGRILSFDL
GASQAYAELMVQARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|