Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 109669..110269 | Replicon | plasmid pKOB1 |
| Accession | NZ_CP117859 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LV478_RS01505 | Protein ID | WP_130732983.1 |
| Coordinates | 109669..110013 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LV478_RS01510 | Protein ID | WP_130732982.1 |
| Coordinates | 110006..110269 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS01480 (LV478_01485) | 105820..106029 | - | 210 | Protein_103 | recombinase family protein | - |
| LV478_RS01485 (LV478_01490) | 106222..106962 | + | 741 | Protein_104 | OB-fold nucleic acid binding domain-containing protein | - |
| LV478_RS01490 (LV478_01495) | 107403..107510 | - | 108 | WP_275877900.1 | helix-turn-helix domain-containing protein | - |
| LV478_RS01495 (LV478_01500) | 107686..109029 | - | 1344 | WP_034926246.1 | IS1380 family transposase | - |
| LV478_RS01500 (LV478_01505) | 109101..109604 | - | 504 | WP_275877901.1 | recombinase family protein | - |
| LV478_RS01505 (LV478_01510) | 109669..110013 | - | 345 | WP_130732983.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LV478_RS01510 (LV478_01515) | 110006..110269 | - | 264 | WP_130732982.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LV478_RS01515 (LV478_01520) | 110331..110519 | - | 189 | WP_130732981.1 | hypothetical protein | - |
| LV478_RS01520 (LV478_01525) | 110697..111056 | - | 360 | WP_248705407.1 | hypothetical protein | - |
| LV478_RS01525 (LV478_01530) | 111181..111623 | + | 443 | Protein_112 | IS5 family transposase | - |
| LV478_RS01535 (LV478_01540) | 113202..114218 | - | 1017 | WP_275877902.1 | IS110 family transposase | - |
| LV478_RS01540 (LV478_01545) | 114299..114616 | + | 318 | Protein_115 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..259334 | 259334 | |
| - | inside | IScluster/Tn | - | - | 94802..114616 | 19814 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13277.17 Da Isoelectric Point: 10.2205
>T272425 WP_130732983.1 NZ_CP117859:c110013-109669 [Komagataeibacter oboediens]
MTEYAIEFDDRALREWDGLDGSIRRKFEKKLEKLVLNPHSPGNELHGDLAGFYKIKLRRDGYRLVYQVVEQRIVIFVIAV
GRREDNEIYTAATKRVPETPADRTKPSSGKSRKR
MTEYAIEFDDRALREWDGLDGSIRRKFEKKLEKLVLNPHSPGNELHGDLAGFYKIKLRRDGYRLVYQVVEQRIVIFVIAV
GRREDNEIYTAATKRVPETPADRTKPSSGKSRKR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|