Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 106121..106704 Replicon plasmid pKOB2
Accession NZ_CP117858
Organism Komagataeibacter oboediens strain NCIB 8034

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag LV478_RS00580 Protein ID WP_275877770.1
Coordinates 106121..106465 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag LV478_RS00585 Protein ID WP_034932865.1
Coordinates 106462..106704 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV478_RS00545 (LV478_00545) 101126..101455 + 330 WP_275877766.1 type II toxin-antitoxin system RelE/ParE family toxin -
LV478_RS00550 (LV478_00550) 102587..103528 + 942 WP_275877767.1 epoxide hydrolase -
LV478_RS00555 (LV478_00560) 103778..104389 - 612 WP_275877768.1 LysR substrate-binding domain-containing protein -
LV478_RS00560 (LV478_00565) 104411..105274 + 864 Protein_111 MFS transporter -
LV478_RS00565 (LV478_00570) 105342..105776 + 435 WP_275877769.1 GFA family protein -
LV478_RS00570 (LV478_00575) 105787..105882 - 96 Protein_113 transmembrane phosphoesterase -
LV478_RS00575 (LV478_00580) 105905..106024 + 120 Protein_114 FAD-dependent monooxygenase -
LV478_RS00580 (LV478_00585) 106121..106465 - 345 WP_275877770.1 endoribonuclease MazF Toxin
LV478_RS00585 (LV478_00590) 106462..106704 - 243 WP_034932865.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
LV478_RS00590 (LV478_00595) 106973..107641 - 669 WP_275877771.1 MucR family transcriptional regulator -
LV478_RS00595 (LV478_00600) 108026..108340 - 315 WP_198284466.1 WGR domain-containing protein -
LV478_RS00600 (LV478_00605) 108850..109239 + 390 WP_217420063.1 hypothetical protein -
LV478_RS00605 (LV478_00610) 109301..110305 + 1005 WP_217420062.1 thiol:disulfide interchange protein -
LV478_RS00610 (LV478_00615) 110302..110838 + 537 WP_217420061.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..173561 173561


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(13-110)

Antitoxin

SpoVT-AbrB domain

(6-48)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 12381.34 Da        Isoelectric Point: 9.7053

>T272424 WP_275877770.1 NZ_CP117858:c106465-106121 [Komagataeibacter oboediens]
VSTKSSVTWIPDCGDIVWLEFDPQAGREQAGHRPAVVLSPASYNAKAGMMLCCPTTTKIKGYPFEVAVAGKPASVVLSDQ
VRSLDWRVRNAKLKGKISAEELEAVRQRARLLVG

Download         Length: 345 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8831.06 Da        Isoelectric Point: 4.4205

>AT272424 WP_034932865.1 NZ_CP117858:c106704-106462 [Komagataeibacter oboediens]
MQIIVRKWGNSAAIRLPTGVLEAVSLKIDQVVDVHEEDGRIIIEPVRATPLKLEDLVAGITDLNRHDEIDFGQSVGGESW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References