Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 106121..106704 | Replicon | plasmid pKOB2 |
| Accession | NZ_CP117858 | ||
| Organism | Komagataeibacter oboediens strain NCIB 8034 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LV478_RS00580 | Protein ID | WP_275877770.1 |
| Coordinates | 106121..106465 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | LV478_RS00585 | Protein ID | WP_034932865.1 |
| Coordinates | 106462..106704 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV478_RS00545 (LV478_00545) | 101126..101455 | + | 330 | WP_275877766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LV478_RS00550 (LV478_00550) | 102587..103528 | + | 942 | WP_275877767.1 | epoxide hydrolase | - |
| LV478_RS00555 (LV478_00560) | 103778..104389 | - | 612 | WP_275877768.1 | LysR substrate-binding domain-containing protein | - |
| LV478_RS00560 (LV478_00565) | 104411..105274 | + | 864 | Protein_111 | MFS transporter | - |
| LV478_RS00565 (LV478_00570) | 105342..105776 | + | 435 | WP_275877769.1 | GFA family protein | - |
| LV478_RS00570 (LV478_00575) | 105787..105882 | - | 96 | Protein_113 | transmembrane phosphoesterase | - |
| LV478_RS00575 (LV478_00580) | 105905..106024 | + | 120 | Protein_114 | FAD-dependent monooxygenase | - |
| LV478_RS00580 (LV478_00585) | 106121..106465 | - | 345 | WP_275877770.1 | endoribonuclease MazF | Toxin |
| LV478_RS00585 (LV478_00590) | 106462..106704 | - | 243 | WP_034932865.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| LV478_RS00590 (LV478_00595) | 106973..107641 | - | 669 | WP_275877771.1 | MucR family transcriptional regulator | - |
| LV478_RS00595 (LV478_00600) | 108026..108340 | - | 315 | WP_198284466.1 | WGR domain-containing protein | - |
| LV478_RS00600 (LV478_00605) | 108850..109239 | + | 390 | WP_217420063.1 | hypothetical protein | - |
| LV478_RS00605 (LV478_00610) | 109301..110305 | + | 1005 | WP_217420062.1 | thiol:disulfide interchange protein | - |
| LV478_RS00610 (LV478_00615) | 110302..110838 | + | 537 | WP_217420061.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..173561 | 173561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12381.34 Da Isoelectric Point: 9.7053
>T272424 WP_275877770.1 NZ_CP117858:c106465-106121 [Komagataeibacter oboediens]
VSTKSSVTWIPDCGDIVWLEFDPQAGREQAGHRPAVVLSPASYNAKAGMMLCCPTTTKIKGYPFEVAVAGKPASVVLSDQ
VRSLDWRVRNAKLKGKISAEELEAVRQRARLLVG
VSTKSSVTWIPDCGDIVWLEFDPQAGREQAGHRPAVVLSPASYNAKAGMMLCCPTTTKIKGYPFEVAVAGKPASVVLSDQ
VRSLDWRVRNAKLKGKISAEELEAVRQRARLLVG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|