Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 100870..101455 | Replicon | plasmid pKOB2 |
Accession | NZ_CP117858 | ||
Organism | Komagataeibacter oboediens strain NCIB 8034 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LV478_RS00545 | Protein ID | WP_275877766.1 |
Coordinates | 101126..101455 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W5YEQ9 |
Locus tag | LV478_RS00540 | Protein ID | WP_010511780.1 |
Coordinates | 100870..101133 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LV478_RS00510 (LV478_00510) | 96119..96550 | - | 432 | Protein_101 | transposase | - |
LV478_RS00520 (LV478_00520) | 97899..98234 | - | 336 | Protein_103 | helix-turn-helix domain-containing protein | - |
LV478_RS00525 (LV478_00525) | 98340..99578 | - | 1239 | WP_025440189.1 | type II toxin-antitoxin system HipA family toxin | - |
LV478_RS00530 (LV478_00530) | 99575..99877 | - | 303 | WP_025440188.1 | helix-turn-helix transcriptional regulator | - |
LV478_RS00535 (LV478_00535) | 100167..100580 | + | 414 | Protein_106 | transposase | - |
LV478_RS00540 (LV478_00540) | 100870..101133 | + | 264 | WP_010511780.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LV478_RS00545 (LV478_00545) | 101126..101455 | + | 330 | WP_275877766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LV478_RS00550 (LV478_00550) | 102587..103528 | + | 942 | WP_275877767.1 | epoxide hydrolase | - |
LV478_RS00555 (LV478_00560) | 103778..104389 | - | 612 | WP_275877768.1 | LysR substrate-binding domain-containing protein | - |
LV478_RS00560 (LV478_00565) | 104411..105274 | + | 864 | Protein_111 | MFS transporter | - |
LV478_RS00565 (LV478_00570) | 105342..105776 | + | 435 | WP_275877769.1 | GFA family protein | - |
LV478_RS00570 (LV478_00575) | 105787..105882 | - | 96 | Protein_113 | transmembrane phosphoesterase | - |
LV478_RS00575 (LV478_00580) | 105905..106024 | + | 120 | Protein_114 | FAD-dependent monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..173561 | 173561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12478.11 Da Isoelectric Point: 5.2494
>T272423 WP_275877766.1 NZ_CP117858:101126-101455 [Komagataeibacter oboediens]
MTEYAIEFDDRALREWDGLDGSIRRKFEKKLEKLVLTPHSPGNELHGDLAGFYKIKLRQDDYQVVEQRIVIFVIAMGRRE
DDEIYTAATGRVPETPVTAANPGRLGTDR
MTEYAIEFDDRALREWDGLDGSIRRKFEKKLEKLVLTPHSPGNELHGDLAGFYKIKLRQDDYQVVEQRIVIFVIAMGRRE
DDEIYTAATGRVPETPVTAANPGRLGTDR
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|