Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1292512..1293429 | Replicon | chromosome |
Accession | NZ_CP117857 | ||
Organism | Bacillus velezensis strain PT4 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A807M4S7 |
Locus tag | PO845_RS06675 | Protein ID | WP_060674890.1 |
Coordinates | 1292683..1293429 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PO845_RS06670 | Protein ID | WP_003154807.1 |
Coordinates | 1292512..1292682 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO845_RS06630 (PO845_06630) | 1287724..1289313 | + | 1590 | WP_053573489.1 | hypothetical protein | - |
PO845_RS06635 (PO845_06635) | 1289326..1289751 | + | 426 | WP_053573490.1 | hypothetical protein | - |
PO845_RS06640 (PO845_06640) | 1289756..1289953 | + | 198 | WP_012117366.1 | XkdX family protein | - |
PO845_RS06645 (PO845_06645) | 1290010..1290771 | + | 762 | WP_060674886.1 | hypothetical protein | - |
PO845_RS06650 (PO845_06650) | 1290823..1291086 | + | 264 | WP_031378810.1 | hemolysin XhlA family protein | - |
PO845_RS06655 (PO845_06655) | 1291100..1291363 | + | 264 | WP_003154813.1 | phage holin | - |
PO845_RS06660 (PO845_06660) | 1291377..1292255 | + | 879 | WP_060674888.1 | N-acetylmuramoyl-L-alanine amidase | - |
PO845_RS06665 (PO845_06665) | 1292290..1292415 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PO845_RS06670 (PO845_06670) | 1292512..1292682 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PO845_RS06675 (PO845_06675) | 1292683..1293429 | - | 747 | WP_060674890.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PO845_RS06680 (PO845_06680) | 1293535..1294533 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PO845_RS06685 (PO845_06685) | 1294546..1295163 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PO845_RS06690 (PO845_06690) | 1295449..1296765 | - | 1317 | WP_007610842.1 | amino acid permease | - |
PO845_RS06695 (PO845_06695) | 1297088..1298038 | + | 951 | WP_031378808.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29081.56 Da Isoelectric Point: 4.7755
>T272422 WP_060674890.1 NZ_CP117857:c1293429-1292683 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGITRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMSDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGITRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMSDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A807M4S7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |