Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 526504..527141 | Replicon | chromosome |
Accession | NZ_CP117857 | ||
Organism | Bacillus velezensis strain PT4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PO845_RS02575 | Protein ID | WP_003156187.1 |
Coordinates | 526791..527141 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PO845_RS02570 | Protein ID | WP_003156188.1 |
Coordinates | 526504..526785 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO845_RS02550 (PO845_02550) | 522869..523468 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PO845_RS02555 (PO845_02555) | 523561..523926 | + | 366 | WP_053104569.1 | holo-ACP synthase | - |
PO845_RS02560 (PO845_02560) | 524091..525098 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
PO845_RS02565 (PO845_02565) | 525215..526384 | + | 1170 | WP_039252648.1 | alanine racemase | - |
PO845_RS02570 (PO845_02570) | 526504..526785 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PO845_RS02575 (PO845_02575) | 526791..527141 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PO845_RS02580 (PO845_02580) | 527259..528080 | + | 822 | WP_280955859.1 | STAS domain-containing protein | - |
PO845_RS02585 (PO845_02585) | 528085..528450 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PO845_RS02590 (PO845_02590) | 528453..528854 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PO845_RS02595 (PO845_02595) | 528866..529873 | + | 1008 | WP_280955860.1 | PP2C family protein-serine/threonine phosphatase | - |
PO845_RS02600 (PO845_02600) | 529937..530266 | + | 330 | WP_033575044.1 | anti-sigma factor antagonist | - |
PO845_RS02605 (PO845_02605) | 530263..530745 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
PO845_RS02610 (PO845_02610) | 530711..531499 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PO845_RS02615 (PO845_02615) | 531499..532101 | + | 603 | WP_039252641.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T272421 WP_003156187.1 NZ_CP117857:526791-527141 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|